KEGG   Coccidioides posadasii: CPC735_029720Help
Entry
CPC735_029720     CDS       T01332                                 

Definition
asparaginase, putative (EC:3.5.1.1)
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
cpw  Coccidioides posadasii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 566 aa AA seqDB search
MPYDIDKAIGSFEAMTVEQDQDQLRAHGLCPESRVLIVMTGGTICMRRSSSGFVPARGFQ
DAALRPSSTFNDGSNPGPVDVVINASGERKSYPTLRTPLSIYDARVRYAVYEFEELLDSS
SIDAKGWAQIARTIYWNYTLFDGFVVLHGTDSLAYTSSALSFMFQNLGKPVILTGSQAPM
LELQNDATDNLLGSLIIAGHFMIPEVCLYFNHNLFRGTRATKVAASDFAAFASPNFPPLA
VTTSMRTHVKWEQVHKPTTIKHFSIQMNLDTTHVACLRIFPGIKPEMVDAVLRLPGLRGL
VLETFGAGNAPGGQDNAMTKVLADAIHRGIVIVNVTQCLSGSVSPVYAPGMTLSRAGVVA
GLDMTTEAALTKLAFLLGVPDTTPQSVARDMSISLRGELTEHSHPVFRHPDGALPDRIKN
LAALGYAVAQGNLEKVKEIMRTEQDWILNDADYSGNTPLHLAATSPNLGILRYFLLHGGS
VHLRNYAGRTPLFLAANAGLIDHVNLLRESGAHLHEDERGVAELHARGRPDIWTLAGVDM
EVVNRMEGGSDSNGERKTNGNAPVPT
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgccttacgacatagacaaggcgatcggttcattcgaagccatgacggttgagcaggac
caagaccaactcagggcacatggcctctgccccgaatcccgcgtcctcatcgtcatgacg
ggcggcacaatctgcatgcgccgttcctcgtccgggttcgtgccagcccggggtttccaa
gacgccgctcttcgtccatcctcaacgttcaacgacggctcgaatcccgggccagtcgac
gtagtcatcaacgcatctggcgagcggaagagttaccctacgctgcgcaccccgttaagc
atatatgacgcgcgggtccgatatgccgtgtacgagttcgaggagctgctagatagcagc
tcgatcgacgcaaaagggtgggcacagatcgcgagaactatctattggaattacaccctc
ttcgacggcttcgttgtcttgcatggcaccgacagcctggcgtatacctcctccgcgctg
agcttcatgttccagaatctaggcaaaccggtcatcctcacgggttcgcaggcgccgatg
ctggagctccagaacgacgcaacagataatctactcggatctttgatcatcgcaggtcat
tttatgattccggaagtgtgcttgtattttaatcataatctcttccgtggaactcgagca
accaaggttgcagcgagcgattttgcggcctttgcatcgccgaatttccctccgttggct
gtgacgacgtcgatgcggacgcacgtaaagtgggaacaggtgcataagcctactactatt
aaacatttcagcatccagatgaacctagatacgacgcatgtggcgtgcttgaggatattc
cctggtataaagcctgagatggttgatgcggtgcttcgactgcctggattacgcggcttg
gtgctggagacctttggcgccgggaacgcacctggaggacaagacaacgccatgaccaag
gtgcttgctgatgctattcaccgtggaattgtcattgtgaatgtgactcagtgcttatct
gggagcgtgagccctgtatacgctccgggaatgactttatcacgggcgggtgtggttgca
ggattagacatgaccacggaggcggctctcacaaagctcgccttcttgctaggggtgccc
gacacgacgccacagtctgtcgctcgagatatgtcgatctcccttcggggtgaactcacg
gagcactcacatcccgtgttcagacatcctgacggtgcgctgcctgatcggataaagaat
ctggcggcgcttggttatgcagttgcccaggggaacttggagaaggtgaaagaaatcatg
cgaacggagcaggattggattcttaacgatgcagattattctgggaacacaccattgcac
ctcgctgcgacttcgcccaatcttggcatcttgaggtactttctcctccacggcggctct
gttcatctgcgcaactatgcagggcgcacgccgttgtttctggccgccaacgcgggactg
atcgaccatgtcaatttactacgggagtccggagcgcacctgcacgaggacgagcgaggt
gtcgcagagttacacgcccgtggacgaccagatatatggacgctggcaggagttgacatg
gaagtggtgaaccgaatggagggggggtccgattcaaatggggagagaaagacaaatggt
aacgcgccggttcctacatga

DBGET integrated database retrieval system