KEGG   Coccidioides posadasii: CPC735_030100Help
Entry
CPC735_030100     CDS       T01332                                 

Definition
(RefSeq) Ubiquitin carboxyl-terminal hydrolase family protein
  KO
K11838  ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
cpw  Coccidioides posadasii
Brite
Enzymes [BR:cpw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CPC735_030100
Peptidases [BR:cpw01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CPC735_030100
Ubiquitin system [BR:cpw04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    CPC735_030100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: USP7_ICP0_bdg USP7_C2 UCH UCH_1 MATH
Motif
Other DBs
NCBI-GeneID: 9695314
NCBI-ProteinID: XP_003069819
UniProt: C5P4N4
AA seq 1128 aa AA seqDB search
MDNLEESGMVVDEFDQYSNDHTDDVVLVSPSGSPSEPEPEFPLADDYESMITRVLPELPD
TETLEQTHHTWHIQNWTRMERKEHGPIFECGGSPWRVLFFPFGNQVTEYASFYLEHGYEE
APPEGWSRCVQFALVLWSKNNPSIYVSHVATHRFNASDGDWGFTRFCELRKLFHGPFDEN
GSPLIENEEACLTVYMRVVKDPTGVLWHSFKDYDSKKETGMVGLKNQGATCYLNSLLQSL
YFTNSFRKAVYQIPTEEDSKISNSAWTLQRLFYSLQTSDNPVSTQELTSSFGWESKQIFE
QQDVQELCRKLMERLEEKMKGTPVEKALHDLFVGKTKTYISCINVDYESSRIEDFWDIQL
NVRGNKTLDDSFKDYIQVETLEGENKYDAGDPYGLQDAKKGVIFESFPPVLHLHLKRFEY
DIHRDAMMKINDRHEFPEEFDASPYLSENADRSEPWVYQLYGVLVHTGELNAGHYYAFLR
PTKDGYFYRFDDDRVVRATMKQTLEENFGGDWITLPNGNAGMRQAHFARGYSTKRSMNAY
MLVYLRKSRVDDILVEVMKNDVPCHIEKKIAEERAELARRKKEREEQHLYMNVSLISDES
FKHHHSFDLTSPDLDPNDPAAPKAYRILRATKVGEFAKQVAEEREVAPEQVRLWVMVNRQ
NKTTRPDQHLRDMEMSMEQAFNEFGTKNNPFRLWLEIGEPGVDGKVSWPDSRGPNAHTLI
FLKYFDVHAQTLTGVKHVFVRKHAKVSEISGTILELMNWAPGTSFLLYEEIRHSMIDPMK
PKHTFHQSEIQDGDIICFQRSIPESELPPTVIYRNVQQYYDFLLNRILVTFAPIEPNPEQ
TFTLTLSKKMTYEQFSTKVGEHLKVEPTHLRFAPVIISSGAPKPFIKRNVAQNLGQMLTS
PYPGTGYSHRSDVLYYEILETSLSEFEMKKNIKITWLSEGIAKEQIHEVLVAKNGVVSDV
IESLQKKANIDDETIRNVRLYEAYSGKIYKELYDTYSVAGITDYVTVFAERIPEDELNMQ
EGEFRINAFNFDKEPQKAYGCPFKFVVKPGEKFKDTKERLSKRTGIKGKQFERIKFALVS
RTPYSKPLYLEDDHILADLTTDSEQQLGLDHVNKNRNFWGRSESFFIR
NT seq 3387 nt NT seq  +upstreamnt  +downstreamnt
atggacaatctggaggagagtggtatggtggttgatgagtttgaccagtacagtaatgac
cacaccgatgatgtcgttcttgtttcgccatcaggctcgccgagtgagcctgaacctgaa
ttccccctcgccgatgattatgaatcaatgatcacaagggttcttcccgaactccccgac
acggaaactcttgaacagacgcatcacacatggcatatccagaactggacgaggatggaa
aggaaagaacatgggccgattttcgagtgtggagggtcaccatggagagtcctttttttc
ccgtttgggaatcaggtgacggaatatgcgtcgttttacctcgaacacggttacgaagag
gcgccccctgaaggctggtcccggtgtgtccagttcgccctcgtcttgtggagcaagaat
aatccttccatttacgtttcgcacgttgctacgcaccgatttaacgccagtgatggagat
tgggggttcacacgattttgtgagcttcgcaagctgttccatggcccgtttgatgagaat
ggttctccgttgatagagaatgaggaggcttgccttacagtgtatatgcgagttgtaaag
gatcccacaggagttctgtggcacagtttcaaagactatgattccaagaaggaaaccggc
atggtcggcctcaaaaatcagggtgccacatgttatttgaactccctcctacagtctctc
tatttcaccaactccttccgaaaggccgtttatcaaatccccactgaagaagattccaaa
atctcaaatagcgcctggactttacagcgattgttctattccctccagacgagtgacaat
ccggtatcgacacaagagcttacttcttcctttggatgggagtcgaaacagatttttgag
cagcaagatgtgcaagaattgtgccgaaagctgatggaacgcttggaggagaagatgaaa
ggcactcccgtagaaaaggccctccacgaccttttcgttggaaagacgaagacctacatt
tcttgcataaacgttgattatgaatcttcacgaatagaggacttttgggatatccaactt
aatgtccgaggcaacaagactctcgatgacagtttcaaagattacatccaggtggaaacg
cttgaaggggagaacaagtatgatgccggtgacccctatggattacaggacgcgaagaaa
ggtgttatatttgaaagtttcccacccgtcttacatctccacctgaagcgatttgagtac
gacatccaccgtgacgcgatgatgaagattaatgatcggcatgaattcccagaggaattt
gatgcttccccttacctttctgaaaatgcggataggtcggaaccttgggtatatcaactc
tacggtgtcctggttcacactggggagttaaatgccggccattattacgcgtttttgaga
ccgacgaaagacggctacttttaccgatttgatgacgacagagttgttagggctactatg
aaacagaccttggaggagaactttggtggagattggataactctccccaacggcaacgct
ggaatgcgtcaagctcattttgcccggggatactccacaaagcgatcaatgaatgcatac
atgttggtatatcttcgcaaatcgcgggtggacgatatcctcgtggaagtaatgaaaaat
gacgttccttgtcacattgaaaagaagattgctgaggaacgggccgagcttgcgagacgg
aaaaaggagcgcgaggaacaacatctttatatgaacgtcagcttaatatcagatgaatcc
ttcaagcatcaccatagctttgacctcacgagtcctgacctagaccctaacgatcctgcc
gctccgaaggcataccggattttacgtgctactaaagttggggaatttgcgaagcaggtc
gctgaagaaagggaggtagctccggagcaggtacggctttgggttatggttaatcgccaa
aataaaaccacacgcccagatcaacatttaagagatatggaaatgtccatggagcaagcg
ttcaatgaatttggaactaaaaacaacccttttcgactctggctggagataggcgaacct
ggagtcgacgggaaagtttcttggccggattcccgaggacccaatgcccatactcttatt
ttcttgaagtattttgatgtccacgctcagacattgacgggagtcaagcatgtttttgtt
aggaagcatgcgaaggtgtccgaaatcagtggcacaatccttgaactgatgaactgggca
cctggaacatctttcttgttatacgaggaaatcagacattcaatgattgatccgatgaaa
ccaaagcacacatttcatcagtctgagattcaggatggcgacattatctgcttccagcga
tcaatcccagagtcagagctgccgcccaccgtgatataccgcaacgttcaacaatattat
gatttcctcttgaaccgtatcctcgtcacatttgcaccgattgagcctaatcctgaacaa
acatttacattgacactcagtaaaaagatgacatatgaacaattctcaacaaaggtcggc
gagcatttgaaagttgaaccaactcatctacgatttgcgcctgttattataagcagtgga
gcgccaaagcctttcatcaaacgaaatgttgcacagaatctcgggcaaatgctcacaagt
ccatacccaggtactggctattctcatcgctccgatgtgctttactacgaaatcttagaa
accagtctgagcgagttcgagatgaagaagaatattaaaatcacctggctatctgaagga
atcgctaaagagcaaatacatgaagtccttgtcgccaagaatggcgtcgtttccgatgtg
attgaaagtttacaaaagaaagcgaatattgacgatgagaccatacggaacgtgcgactc
tacgaagcttactcaggcaagatttacaaagagctttacgacacgtatagcgtggctggt
atcactgattatgttaccgtgttcgccgagagaataccagaggacgaactgaacatgcaa
gaaggtgaatttaggattaatgcattcaattttgataaggagccacagaaggcatatggc
tgtccgttcaaatttgtggttaagccgggggagaaattcaaggacaccaaagaacggtta
tcaaagcggacgggtatcaagggcaagcagtttgaaaggattaagttcgccctcgtatcc
cgcactccgtattcaaaaccgttgtaccttgaagatgaccatatacttgccgaccttacg
accgattccgagcagcaactcggtcttgaccacgtaaataaaaatcggaatttctggggc
cggagcgagagcttcttcatccgatag

DBGET integrated database retrieval system