KEGG   Coccidioides posadasii: CPC735_030580Help
Entry
CPC735_030580     CDS       T01332                                 

Definition
alkaline phosphatase family protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cpw  Coccidioides posadasii
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CPC735_030580
Enzymes [BR:cpw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CPC735_030580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 590 aa AA seqDB search
MSSARKAIITLSSTTIRVLVYVEEAHVSAFKSLLTGVPSTTSKAASRATIGVNIFLSLLA
FDFMLRGLLFYPTNELSFSRVGYVSSTTAKILVREPKQNLPLRISYQELSDDRAGPAVTV
GTLDPLDESTDFTYPVSITGLNPSTKYRYSLSNNQSGEFTTAPELGSPKSKELTFVTSSC
IKPNFPYNPFSHPFQIHGIDVLTSTLTRLGEALRPSFMLFLGDFIYIDVPWRFGSSVQHY
RSEYRRVYSSPSWRIPPDSPANIPWIHTLDDHEIANDWASGNSTPPYPAAVDPYLHYHVN
VNPPIPEHPHSIPSNTSYFSFINGPASFFLLDTRTYRSEPSREDSSMLGFAQLQALIEYI
LRPESEGVKWKIITSSVPFTKNWHVGTPDTWGGFLKERRTIFEAMWKAELELGVRIVLLS
GDRHEFAATRFPDPILSSTSAPEPFSGAGRGIHEFCVGPLSQFYLPVRSYHQEDDEDVAI
KYVPDGNFKFGLISIKADESEQPTSRLTYSLYVNGKETWRYTLETPLAATRGRALPPGKV
VFDYVDNWEEQVRQRAGKWAAYAGERSGWLGRAMGKARDEFLRSARVDEA
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcagctcggaaagcgatcatcactttaagctcgactactattcgggttcttgtc
tatgtagaagaagcacatgtatccgccttcaagtctttattgacgggtgtcccatcaact
acttcaaaggctgcgagccgagcaacaatcggggtcaatatatttctgtctcttcttgcg
tttgatttcatgctgcgaggcctcctattttacccaacgaatgaactttcattctctcgc
gtcggatacgtatcttcaaccacggcaaaaattcttgttcgagagccaaagcaaaatctg
ccccttcgtatatcataccaggagcttagcgacgatcgagctggcccggcagtgacagtg
ggaaccttggaccctctagatgaatcaacagattttacgtacccggtttcgattactggg
cttaatccttcaactaaataccggtactcgttgtccaacaatcaatctggggagttcact
acggcaccggaactcggctctcccaagtcgaaagagctgacatttgtaacttcgagctgc
ataaaaccgaattttccctacaaccccttttcccatcctttccaaattcatgggattgac
gtcctcacttcgacattgacaagattgggcgaggcgcttcgcccttcctttatgctcttc
ttaggtgattttatctatattgacgtaccatggcgatttgggtcatccgtacagcattac
cgaagcgagtatcgcagggtttactcctcgcctagttggcgtattcctccagattcccct
gctaatatcccatggatccatactctggacgatcatgaaatcgccaacgactgggcctct
ggaaattccactcctccgtacccagcagctgtggatccatacttgcactatcatgtcaac
gttaaccctccaataccagaacacccacattccattccgtctaacacaagttatttttca
tttatcaacggccctgcttcttttttccttttggatacgagaacttatcgctctgagccg
tcccgcgaggactctagcatgctaggcttcgcgcagctacaggcgctgatcgaatatatc
ttacgcccggagtcggagggggtaaaatggaaaatcatcactagtagcgtgccgtttact
aaaaactggcatgtgggtacgccggatacctggggtggctttctgaaagaaaggcggacg
attttcgaagccatgtggaaagcagaactcgaacttggtgtacggattgttctcctaagc
ggtgacagacatgagtttgccgccacgcggtttccagatccaatcctttcatctacctcg
gccccggagccattttctggtgctggaagaggtattcatgagttctgtgtcggcccactc
agccagttttaccttccggtgagatcgtatcaccaggaggatgatgaagatgtggctatc
aagtacgtgccagatggaaatttcaagtttggccttattagtatcaaagccgatgagagt
gaacagcctacctcacgcctgacgtactcgttgtatgttaatggaaaggagacttggaga
tacacgctcgagactcctttggcggctacgaggggtcgtgcgcttcctcccggaaaagtg
gtgttcgactacgtcgataattgggaagagcaagtgaggcaaagggccggaaaatgggcg
gcctacgctggtgagagatccggctggctcgggcgagctatgggcaaggctcgggatgaa
ttcctccggagcgctagggttgatgaagcatag

DBGET integrated database retrieval system