KEGG   Coccidioides posadasii: CPC735_032030Help
Entry
CPC735_032030     CDS       T01332                                 

Definition
kinase domain containing protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cpw  Coccidioides posadasii
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:cpw04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 397 aa AA seqDB search
MAMETIRQPQEQLPKPPPVRCRPEIDCEPQDIDTKKLGFPPWPSSRPKTPQDIVENREHI
KERLPKHKLKVEDFELLKTLGTGTFARVWLVRLKNVKDKNNSIFALKVLRKADVIELKQV
EHVRNENNALHAVAGHPFITTLIASFSDDQCLYMLLDYCPGGEIFSFLRRIRRFNEPTAK
FYAAEIVLILEYLHDVQGVAYRDLKPENILLDAEGHLKLVDFGFAKQLYSHETYTLCGTP
EYLAPEVIHNSGHGLAVDWWALGILIYEFLVGQPPFWDPNPLRIYEQIVEGRLRFPSHVT
PEARDIISALCKTNPSERLGYISGGTKRVKEHPFFKGINWDDLYHRRIPGPIIPRVDHPA
DAGNFEEYPPPPDPSTQTVYTEEMKKKYEACFKDFND
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggagacgatccggcagccgcaggagcaattacccaagccgccaccggtccgg
tgccggccggagatagattgcgaaccccaagacatcgacaccaagaaactcgggttcccg
ccctggccttcctcaaggcccaagacgccgcaggatatcgttgagaatcgagagcacatc
aaggagcgactgcctaaacacaaattgaaggttgaagatttcgaattactgaagacgctg
gggaccggcacgtttgcgcgagtatggctcgttcggctcaagaatgtaaaggacaagaac
aactcaattttcgcactaaaggtccttcgcaaagctgatgtcatcgaactcaaacaagtg
gaacatgtccgtaatgagaacaatgctcttcacgctgttgctggacatccgttcatcaca
actctaattgcctctttctccgacgaccaatgcctctacatgctattagactattgcccc
ggcggtgaaatattcagcttcttgcgtcgcatacgacgattcaacgagcccaccgctaaa
ttctacgctgccgaaatagtattaatccttgaatacctccacgacgtacagggcgttgca
tatcgtgacctaaaaccagagaacatccttcttgacgctgaggggcacctcaaactagtt
gatttcggtttcgcgaagcaactctatagtcatgagacatataccctctgtggaacaccc
gaatatctcgcgccggaagtcatacacaacagtggccatggcctggcagttgactggtgg
gcactaggaattctgatatatgaattcttagtaggacaacctcccttctgggatccaaac
cctttgcggatatatgagcagatcgtcgagggccgcctgcgcttcccgtctcacgtaaca
ccagaagcacgggacataataagtgcgctatgcaagaccaatccgtccgaaagattgggg
tacatatcgggtggaacaaaacgggtgaaggagcacccgttcttcaaaggaataaactgg
gacgatctgtatcatcgacggataccagggccaataataccacgtgttgatcatccggcc
gacgcagggaatttcgaggagtatccgcctccaccagatccaagtacgcaaactgtatat
acggaagagatgaaaaagaagtatgaggcctgttttaaggacttcaacgattaa

DBGET integrated database retrieval system