KEGG   Coccidioides posadasii: CPC735_032030Help
Entry
CPC735_032030     CDS       T01332                                 

Definition
kinase domain containing protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cpw  Coccidioides posadasii
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    CPC735_032030
Enzymes [BR:cpw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CPC735_032030
Protein kinases [BR:cpw01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   CPC735_032030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 397 aa AA seqDB search
MAMETIRQPQEQLPKPPPVRCRPEIDCEPQDIDTKKLGFPPWPSSRPKTPQDIVENREHI
KERLPKHKLKVEDFELLKTLGTGTFARVWLVRLKNVKDKNNSIFALKVLRKADVIELKQV
EHVRNENNALHAVAGHPFITTLIASFSDDQCLYMLLDYCPGGEIFSFLRRIRRFNEPTAK
FYAAEIVLILEYLHDVQGVAYRDLKPENILLDAEGHLKLVDFGFAKQLYSHETYTLCGTP
EYLAPEVIHNSGHGLAVDWWALGILIYEFLVGQPPFWDPNPLRIYEQIVEGRLRFPSHVT
PEARDIISALCKTNPSERLGYISGGTKRVKEHPFFKGINWDDLYHRRIPGPIIPRVDHPA
DAGNFEEYPPPPDPSTQTVYTEEMKKKYEACFKDFND
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggagacgatccggcagccgcaggagcaattacccaagccgccaccggtccgg
tgccggccggagatagattgcgaaccccaagacatcgacaccaagaaactcgggttcccg
ccctggccttcctcaaggcccaagacgccgcaggatatcgttgagaatcgagagcacatc
aaggagcgactgcctaaacacaaattgaaggttgaagatttcgaattactgaagacgctg
gggaccggcacgtttgcgcgagtatggctcgttcggctcaagaatgtaaaggacaagaac
aactcaattttcgcactaaaggtccttcgcaaagctgatgtcatcgaactcaaacaagtg
gaacatgtccgtaatgagaacaatgctcttcacgctgttgctggacatccgttcatcaca
actctaattgcctctttctccgacgaccaatgcctctacatgctattagactattgcccc
ggcggtgaaatattcagcttcttgcgtcgcatacgacgattcaacgagcccaccgctaaa
ttctacgctgccgaaatagtattaatccttgaatacctccacgacgtacagggcgttgca
tatcgtgacctaaaaccagagaacatccttcttgacgctgaggggcacctcaaactagtt
gatttcggtttcgcgaagcaactctatagtcatgagacatataccctctgtggaacaccc
gaatatctcgcgccggaagtcatacacaacagtggccatggcctggcagttgactggtgg
gcactaggaattctgatatatgaattcttagtaggacaacctcccttctgggatccaaac
cctttgcggatatatgagcagatcgtcgagggccgcctgcgcttcccgtctcacgtaaca
ccagaagcacgggacataataagtgcgctatgcaagaccaatccgtccgaaagattgggg
tacatatcgggtggaacaaaacgggtgaaggagcacccgttcttcaaaggaataaactgg
gacgatctgtatcatcgacggataccagggccaataataccacgtgttgatcatccggcc
gacgcagggaatttcgaggagtatccgcctccaccagatccaagtacgcaaactgtatat
acggaagagatgaaaaagaagtatgaggcctgttttaaggacttcaacgattaa

DBGET integrated database retrieval system