KEGG   Coccidioides posadasii: CPC735_032110Help
Entry
CPC735_032110     CDS       T01332                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3, putative
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
cpw  Coccidioides posadasii
Brite
Enzymes [BR:cpw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CPC735_032110
Peptidases [BR:cpw01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   CPC735_032110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 226 aa AA seqDB search
MSHLIHHLGVSPKLGFYDVYSIDDPELLSFIPRPAYGLIFICHGDVYHRARDEEEVSRND
YEGFGPDEPVLWFKQTIGNACGLMALLHCISNGPARHYVQPESGLDRLLKAAVPLSPVDR
ARLLYDSPVLENAHRSAAQMGDTRAPIPSDSCEFHFISFAKGDDGHLWELNGSMKGPVDR
GALAPDEDCLSENALNLGVRTLIGKKSETGEAGFGFSLVALGPSLE
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatttgatacaccatctgggcgtctctccaaagctgggattctacgatgtctac
agcattgatgacccggagttgctctcctttattccccgccctgcgtatgggttgatcttc
atctgccatggagacgtctaccatcgagctcgagacgaggaagaagtatcaaggaatgat
tatgaaggatttggcccagacgagccagtcctttggttcaagcagacaatcggaaatgcc
tgtggcttgatggccttgttacactgtatcagtaatggccctgcgcgccactatgttcag
ccggagtcgggcttggacaggctgctcaaagcagccgtgccactgtctcccgttgatcgt
gcgagattgctctatgattccccggtactggaaaatgcgcatcgttcggccgcgcagatg
ggagacacgcgggctccgattcccagtgatagttgtgaattccacttcattagttttgct
aaaggcgatgatggtcacttgtgggagttgaatggttcgatgaaaggccctgttgatcgc
ggtgccctggcgcctgacgaggattgtttgagcgagaatgccctaaatctgggagtgcgc
acactcattgggaagaaaagtgagaccggtgaggccgggttcggcttcagtttggtggcc
cttggacccagcttagaatga

DBGET integrated database retrieval system