KEGG   Coccidioides posadasii: CPC735_032350Help
Entry
CPC735_032350     CDS       T01332                                 

Definition
anthranilate synthase component II, putative (EC:4.1.3.27)
Orthology
K13501  
anthranilate synthase / indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.3.27 4.1.1.48 5.3.1.24]
Organism
cpw  Coccidioides posadasii
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cpw01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cpw00400]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 764 aa AA seqDB search
MASTELVDHSPSHPTKAQRLDNASNVVLIDNYDSFTWNIYQYLILEGATVTVFRNDVISL
EELIAKKPTQLVISPGPGHPNTDSGISKEAIQYFAGKIPVFGVCMGEQCIIASFGGEVEV
TGEILHGKTSPLKHDGKGVYATLPPNLAVTRYHSLAGIPQTVPECLEVTSWTECENRGGR
GIIMGVRHKKLTVEGVQFHPESILTEHGRTMFRNFLKWKGGTWEEALSSTKSQSTAASEP
TTSKQMSILEKIYAHRKAAVDLQKAIPSQRPADLQAAYDLGIAPPQISFPSRLRDSPFSL
ALMAEIKRASPSKGIISSSTSAPSQARKYAMAGASVISVLTEPEWFKGSIEDLRAVRQSL
EGLPNRPAVLRKEFIFDEYQILEARLAGADTVLLIVKMLPVDLLTHLYEYSCKLGMEPLV
EVNTAEEMAIAVKLGARVIGVNNRDLTSFEVDLGTTSRLMDQVSDSTIVCALSGISGPKD
VEAYRANGVKAVLVGEALMRAEDTSAFVQNLLGPEIQLSPNSLPCSPPLVKICGTRSGDA
ARAAIEAGADLVGIILAQGRTRTVPDEVALEISKVVKTTPRPSLLDNYIRQGPSSQTGLD
YFDNGCRLLRHPSRALLVGVFANQPLSYIISQQQNLGLDIIQLHGSEPIEWARLIPVPVI
KKFSPEDKDITKRAYHALPLLDSGVGGTGERLSLPAVEEALERDDGLRVILAGGLNPENL
VSAVKALGEQSRKVVGVDVSSGVEVDGSQDLGKIRAFVAAAKGL
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atggctagcaccgagctcgtcgatcactccccgagtcaccccaccaaggcccaacgcctc
gataacgcttccaacgtcgtcttgattgacaactatgactccttcacgtggaacatttat
caatatctcatcttagagggtgcgacagtgacagttttcagaaacgatgtcatctccctc
gaggaacttatcgcgaagaagcctacccagctggtcattagtcctggccctggccacccg
aatactgactccggaataagtaaagaggcaattcagtactttgcgggaaagataccggtt
ttcggggtttgtatgggcgagcagtgtataatagcgtcgtttggaggcgaagttgaagtt
actggagagattttacatgggaaaacatctccgttgaaacacgacgggaaaggtgtctat
gctacactcccgcccaatttggcagtgacgagataccattctctggcaggaatcccccaa
actgttcctgaatgcttggaggtgacatcgtggacggaatgcgaaaatcgtggtggtcgg
gggatcattatgggcgtcaggcataagaaattgacagtcgaaggagttcaattccaccct
gagagcatattaaccgagcatggacgcacaatgtttcggaactttttgaagtggaaaggc
ggtacttgggaggaagctctgtccagtacgaagagccaatctactgcagctagcgaaccg
actacctcgaaacagatgtcaatcttggaaaagatatatgcccatcgcaaagctgctgta
gatttacagaaggcaatcccttctcagcggcctgcagatcttcaagcagcatacgatctt
ggtattgcgccgccacaaatttctttccccagtcgattaagggattcaccattttccctg
gctctaatggccgaaataaaaagagcctcgccttctaaaggaataatatcttcctccacg
tccgcaccatcccaagccagaaaatatgctatggctggcgcaagtgtgatatcagtcctc
accgagccagaatggtttaaaggaagtatcgaagatttgcgagcagtgcgacaaagtctg
gagggtttaccaaatcgcccagccgttctgcgaaaggaatttatatttgacgaatatcaa
attctcgaagcccgacttgctggtgctgataccgttcttctcatagtcaaaatgcttccc
gttgacctcttgactcacctttacgaatactcctgtaaattgggtatggagccgcttgtc
gaagttaatactgctgaagagatggccattgccgttaaactcggagcccgtgtaattggt
gttaataatcgcgatcttacaagctttgaggtcgatctgggcactacaagtcgtttaatg
gaccaagtatcggactccacgattgtttgtgcgcttagtggcatatctggccctaaggat
gtcgaagcatatcgtgcaaacggcgtcaaggcggttcttgttggtgaggctcttatgcga
gcagaagatactagcgccttcgtgcagaatctcctggggcctgaaattcaattaagccca
aattctctgccgtgttcaccaccccttgtcaaaatttgcggaactcgctctggggatgct
gcacgtgccgccattgaagccggcgcagatcttgtgggtataattcttgcacagggacgc
acgaggacggtacccgacgaggttgccctggaaatctcgaaggtcgttaaaacaacacca
cgtccttcgctgttggataattacatccggcaaggcccatcttcgcagactggcctggat
tattttgataatggctgtcgattactgcggcatccatctcgcgcgcttctagtgggcgtt
ttcgcaaaccaaccgctctcctacattatctctcaacagcaaaatcttgggcttgacatt
attcaacttcacggatctgaacctatcgagtgggcaaggctaattcccgtgccggttatc
aaaaagttttctcctgaagataaggatattactaagcgtgcctaccatgcccttcccctg
ttggactcgggggttggggggacgggagagagactctcgttacctgcagtggaagaagcc
ctagaacgagatgacggccttcgggtaatacttgctggtggtctgaatcctgaaaacctt
gtttccgctgttaaagccctcggcgaacaaagccggaaggtggtgggtgtcgatgtcagc
agcggtgtcgaggtagacggaagtcaagatctggggaagatcagagcttttgtggccgcg
gcgaaaggcttgtga

DBGET integrated database retrieval system