KEGG   Coccidioides posadasii: CPC735_032410Help
Entry
CPC735_032410     CDS       T01332                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase 1, putative
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
cpw  Coccidioides posadasii
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cpw00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:cpw04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1150 aa AA seqDB search
MAYRSSTESDGRHRSGSKSSSESSQLTPLQDGFTPLSSSAPPGWGFNTSTVASISSIVPS
GPLPSSSAVTSPLHTSIDTSTRNVRNDATDTPFLASPLPLELPESVMGIGTQSTFTDGPL
GNVAFNKAPGIMRRLSRGAASKLGRRGSLNSHDKRDHSSGPVIMRRRSDSKTSVSKDSAL
DSSVEEDDKPDPLKPRCGPDRVSFGDEYRLSLDSTAGVAPRVDPLLQCGSLLTKVTKQRK
KYKTFFLDVDTAKVYWDLSNPSKRFYIDDIKEIRLGPDARNYREEHQVPIEFESRWFTII
FANPEGSKNRPVKALHLIAPTRFIVELWTTTLEQISRYRIGLMVGLAGSGQSETILKAHW
QREIARRFPGSPRPFEDECLDVGAVENLCHSLHVNCSKRVLRGQFARVDADGRGKINFSQ
FQSFVQHLKDRKDIRKIFDSVVAESRDGLSIEEFFEFLRSAQGEDVDKNRDYWASVFERF
VRRSRRSQSLPEALSSSAARMDLDAFSSFLISPANGIYPTHVPPPKFDLPLNDYFISSSH
NTYLLGRQVAGASSTEAYIAALQKGCRCVEIDCWDGPDGRPIVSHGRTMTTSVLFADCIS
VIDRYAFLSSDYPLILSLEVHCNAEQQIAMTNIMKNEFGDKLLLEPLRADWPILPSPEAL
KGKILIKVKTSDESEEKISGSSKVMGRKRSSSSPFIQSTTQNSFPTNSSFSSPPTIGPID
GLPPVLTQPKRSLTGTSLSSASEESDAAFATMPFPGKRKMPKSRVIKVLADLGVYARGYK
WRGFDTPESKQFNHVYSFAERSIETICRDSENKALLEAHNRLYLTRVYPSGYRLRSSNFD
PNSFWRRGVQMAALNWQTFDVGMQMNQAMFAAGNDRTGYVLKPESLRVPPSSRHTMDGKP
KIDRQLVRFRVDVISAQQLPRSRGMGPDDSINPYIEIEILCADDKKKGMAFGEGGVDASN
RNGFSGIGLPHRRRTQIEQKNGFNPIFGDEFKFSLETKYPDLVFVRWIVWNSTDGRSFGG
NNSIQLATFTAKLSSLAQGYRYLPLYDSNGDQYLFSTLFCKITKLESAPAAQRRDNEESK
SERKGIFRQLGQSMFKRALSTEREKDVARQKSRLTGSIRKPDSLNREKNETSSSSSSSSL
PILSTVPSGQ
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
atggcttatcgatcttcaaccgagtcagatggacgccatcgatcaggatccaaatcttcg
tccgaatcctcccagctaactccattgcaagatggtttcactcccctcagctcctctgcg
cctccgggctggggctttaacacctccacggtggcgtctatctcttccattgttccttca
ggtccgcttccaagctctagtgccgtcacctcaccattgcatacgtcgatagacacctca
actcggaacgttcgaaatgatgcaacagataccccattccttgcctcgcccctgccatta
gagttaccagaatcggtaatgggcataggaacgcaatcaaccttcacagacggaccttta
ggaaacgttgcattcaacaaagcgcctggcataatgcggcgactgtctaggggtgctgct
agcaagcttggtcggcgaggatcgctaaattcccatgataaacgagatcatagctcgggt
cccgttattatgcgcagaagaagtgatagtaagacatcagtttccaaagatagcgcactc
gattctagtgttgaggaggacgacaaacctgaccctcttaagccccggtgtggaccggat
cgagtttcatttggcgacgaataccgactttctctggatagcaccgcaggggttgccccg
agagtggatcctcttttgcaatgtggttcacttctcacaaaagtaacgaagcaaagaaag
aaatataagactttctttctggacgttgacactgcgaaggtgtattgggacctctcaaac
ccatccaaacgattttatatcgatgatatcaaagaaataagattgggtccagacgcgcgg
aactatcgagaggaacatcaagttcctatcgaatttgagagccgctggtttacgattatt
ttcgccaaccccgaaggatcgaagaataggccagtcaaggcgctgcatttgatagcacca
actcggttcatcgttgaattgtggactacgactctggaacaaatttccagatatagaatt
ggacttatggttgggttagccggctctggtcaaagtgaaactatattaaaggctcactgg
cagcgtgaaattgctcgaagattccctgggagcccaagaccttttgaagacgaatgcctc
gacgttggcgctgttgaaaatctctgccatagcctccatgtcaattgttcgaaacgagtt
ctacgtggtcaatttgcgagagttgacgcagacgggagggggaaaataaatttctctcaa
ttccaaagcttcgttcaacatctaaaagatcgcaaggacataaggaagattttcgattct
gtagtcgctgagagcagggacggcctaagtattgaggagttctttgagttccttcgcagt
gcacagggagaagatgtcgataagaatagggattattgggcatcggttttcgaaagattt
gttcgaagatccaggcgttcacaaagccttccagaggctctatctagctcggctgcacgc
atggatcttgatgctttctcgtcttttttgatatctcctgcgaacggtatatatccaacc
catgtacccccgccgaagtttgatctgcctttaaacgactacttcatctcaagttcacac
aacacatacctacttggaaggcaagttgctggtgcttcgagcacggaggcgtatatcgct
gcacttcaaaaaggctgccgctgcgtcgaaattgattgctgggatggtccagatggccgt
ccgatcgtctctcatggcaggacaatgaccacgagtgtcctctttgcggactgcatatct
gtcatcgaccgttatgccttcctatcttccgactatcctttgatcttatcgcttgaggtt
cactgtaacgcggaacaacaaatagccatgaccaacatcatgaagaatgaatttggcgac
aaacttctacttgaaccgcttcgggcagattggccgattcttccaagcccggaggcattg
aagggtaaaattttgatcaaagtgaaaacgtctgacgaaagtgaggaaaaaatctccggt
tctagtaaagttatgggccgcaaacgaagctcgagctcccctttcatacagtcgaccacc
caaaattcatttcctacaaattcttcgttctcgtctccaccgacaatcggcccaatcgat
ggactacccccggtgttaactcaaccgaagcgttctctgactggtactagtctgagtagt
gcttccgaggagagtgatgcagcttttgccacaatgccatttcctggtaagaggaagatg
cccaaaagcagagtgatcaaagttctcgcagatcttggtgtctacgctcgtggctataaa
tggcgaggctttgatacgccggaaagcaaacaattcaatcacgtatattcctttgctgaa
cggtctattgaaacaatatgccgagactctgaaaacaaagctcttctagaagcacacaat
cgattgtatctcacaagggtctacccgtcagggtatcgattgcgttcatcgaactttgac
ccaaatagcttctggagacgaggtgttcagatggctgcactcaattggcagacttttgat
gttggaatgcaaatgaatcaagccatgtttgccgctggcaatgatcgtacaggatacgtg
ctcaaaccggaaagcttgcgagtaccaccatcgtcaaggcatacaatggatggcaagcca
aagatcgacagacaattggttcgtttccgcgtggatgtgatttctgctcagcagcttcct
cgatctcgaggaatggggcctgatgatagcatcaatccgtacatcgagatcgaaatactg
tgtgcagatgataagaagaaaggtatggcattcggcgaaggtggtgtggatgcgtcgaac
cgaaatggattttcgggcattggccttcctcaccgtcgtcgaacacagattgagcagaaa
aatggcttcaatccgatcttcggggacgagtttaaattttctctggaaactaaatatcca
gatctcgtcttcgttcgctggatcgtgtggaactccaccgacggccgtagttttgggggt
aacaacagcatacagctagctacattcacagcaaagcttagcagtctggcgcaaggctat
cgatatctgcctctttatgacagcaacggcgatcagtacctattttcaacgctattttgc
aaaatcaccaaactcgaatctgccccagctgcgcaacggcgcgacaatgaagaatccaaa
agcgaacgaaagggtatctttcgacaacttggccagtcgatgttcaagcgtgctctctcg
accgaacgagagaaagatgttgctcgacagaaaagcagactcactggcagcattcgaaaa
ccagattcgttgaaccgagagaagaatgagacatcatcatcatcgtcatcatcatctctc
cctatcctcagcactgtcccatcaggtcagtga

DBGET integrated database retrieval system