KEGG   Coccidioides posadasii: CPC735_033220Help
Entry
CPC735_033220     CDS       T01332                                 

Definition
Diacylglycerol kinase catalytic domain family protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
cpw  Coccidioides posadasii
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CPC735_033220
Enzymes [BR:cpw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     CPC735_033220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 509 aa AA seqDB search
MTLSSLLDCDRSPDGYSSSEEEQLQRVDIGKDSVLAVGPKTLLILTAKSLVIADENAKKK
DSRSCCSPYWCSGKLQRLSIPYFNVLWADVSHEYITIKYAESTSNDDVSVASVYYPVDPA
HKSKTKQWLEELMNAAYGKAQREKKVKVLINPFGGKGRAQKLYSREVEPVFAAAQCEVDV
EITTHQGHAVEIAQNIDLQAYDVIAPASGDGVAYEVFNGLGKRADAGEALRSLAVAHIPC
GSGNAMSWNLYGTGSPSMAALCIVKGLRTPLDLVSITQGDRRTLSFLSQSFGIIAESDLG
TDHIRWMGSARFTYGFLVRLFGKTVYPCDLAVKVEIGDKDDIKDHYRAGLEQKSSHSPRG
SKSETVGLPPLRHGTVADPLPDDWELITHDKMGNFYAGNMGYMAPDANFFPTALPNDGML
DLITIRGDISRLTALQMLMAVENGTLFDMPEVHVQKVSGYRIIPREREDGYISIDGEKVP
FEPFQAEVHKGLGTAISKSGHRYQTPEIR
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcagtagtttgcttgattgcgatcgctcgccagatggatactcgtcgtctgaa
gaggaacagctgcagcgtgtggatatagggaaagattctgtccttgctgttggaccgaaa
acattgttgattttgaccgctaagtctcttgtcatcgctgatgaaaacgcgaagaaaaag
gattcccgtagctgctgttccccatattggtgctctgggaaattgcaaagactatctatt
ccgtattttaacgtcttatgggcggacgtatcccacgagtacatcaccataaaatatgca
gaatcaacctcaaacgacgatgtctcagttgcgtcagtgtactacccagttgatccggcg
cacaaatcgaaaactaaacaatggctcgaggagcttatgaacgcggcttacgggaaagca
cagcgcgaaaagaaagtcaaagtgcttataaatccgttcggagggaaaggtcgagctcaa
aagctgtattccagggaggttgagcctgtattcgcagcagcacaatgcgaagttgatgtt
gaaataactactcatcagggtcatgcggtagagattgcacagaatattgaccttcaagcg
tatgatgtgattgcgcctgcatctggtgatggtgttgcctacgaagtttttaacggattg
ggtaaaagagctgatgctggcgaagcactccgcagtcttgcggtagcccatattccatgt
ggatccggaaatgcaatgagctggaatctttacggtacgggttctccgagcatggctgca
ctttgtatagttaagggtttgagaactcccttagatctcgtctccatcacacaaggagat
agaagaacgctgtcgtttctgtcgcagtcatttggtataattgctgagagcgaccttgga
acggaccatatccgatggatgggtagcgctcgcttcacatatggatttctagttcggctt
tttgggaaaacagtgtatccgtgtgaccttgctgtcaaagttgaaattggcgataaagac
gacatcaaggatcattatcgagccgggttggaacaaaagtcttctcattcaccccgaggt
tctaaatctgaaaccgttggactcccgcctctccggcacggtacggtcgctgatcccctc
cctgacgattgggagcttatcacgcacgacaaaatgggtaacttttatgctggaaacatg
ggatatatggcaccagatgccaatttcttcccaactgcgctaccaaatgatgggatgctc
gatttgataacaattcgcggcgatatttctcggctaactgcgcttcagatgcttatggct
gttgaaaatggtacgctgtttgacatgcctgaagtacacgtccagaaggtttccggctat
aggattattccccgggaaagggaggatggctatattagtatcgatggggagaaagtgcca
tttgagccttttcaagcggaagtccataaaggactcgggaccgctatttcgaaatccggc
cacaggtaccaaacaccggaaatccggtga

DBGET integrated database retrieval system