KEGG   Coccidioides posadasii: CPC735_035040Help
Entry
CPC735_035040     CDS       T01332                                 

Definition
poly(A)+ RNA export protein, putative
Orthology
K14298  
mRNA export factor
Organism
cpw  Coccidioides posadasii
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:cpw03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 359 aa AA seqDB search
MSSALFGSTTSTTGDLSKDVALSSPPEDSISDLAFSSVSDHLAVASWDKKVRIYEINEQG
MSEGKALFEHQGPVLNCCWSPDGTKVVGVGADKAARMLDLAGNPSNPVQVAAHDAPIRCC
RMISNPANSSQPLLVTGSWDKTVKYWDLRQSTPIASLDCQERVYTMDVRNKLLVIGTADR
YINIVNLDQPTKFYKTMQSPLKWQTRVVSCFTDATGFAVGSIEGRCAIQYVEDKDSSSNF
SFKCHRESPSGSTTVSNVYSVNSIAFHPTHGTFSTAGSDGTFHFWDKDAKHRLKGFPNVG
GTISCSTFNRNGNIFAYAVSYDWSKGYTGNTPQTPNKVMMHPVAAEEVRPRPSNARRTR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcagccctctttggctccaccaccagcacgacaggcgatctctctaaggatgtt
gccctgtcctcgcccccggaggatagcatctccgatctcgcattttcaagtgttagcgac
caccttgcagtggcatcatgggataagaaagtccgtatctacgagatcaacgaacaagga
atgagtgaagggaaagcgctgtttgagcaccagggtcctgttctgaactgttgttggtcg
cctgatgggaccaaggttgtcggtgtcggtgcagataaagccgcccgtatgctcgactta
gctggcaaccccagcaatcctgttcaagtcgcagcgcatgacgcgcctattcgatgctgc
cgcatgatttcaaatccagcaaattcaagtcagcctttgctcgtcaccggctcgtgggat
aaaactgtaaagtactgggatttgcgacagtctacgcccattgcgtctctcgattgtcaa
gaacgggtatacacaatggacgttaggaacaagcttctcgtcatcggcacagcagatcga
tatattaatattgtgaatctggaccaacctacaaagttctacaagaccatgcaatcgccc
ctcaagtggcaaacaagagttgtcagctgcttcacggatgctacaggattcgcagttggc
agcattgagggtcgctgtgcgattcagtatgttgaagacaaggattctagctcgaacttc
agtttcaagtgtcaccgcgaaagccccagtggctccacaaccgtcagcaacgtctattcg
gtcaattccatcgccttccaccccacacacggcacattcagtacggcaggcagcgacgga
acgttccatttttgggataaagatgccaagcacagacttaagggatttcccaatgtcgga
gggacgatttcctgttccaccttcaaccgtaacgggaacatttttgcctatgcagtgagc
tatgactggagcaagggatatactggcaatactccacaaactccgaataaggtcatgatg
catcctgtcgccgcagaagaagtccgacctcgcccttcaaacgcacgcaggaccagatga

DBGET integrated database retrieval system