KEGG   Coccidioides posadasii: CPC735_035240Help
Entry
CPC735_035240     CDS       T01332                                 

Definition
Guanylate kinase, putative
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cpw  Coccidioides posadasii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cpw00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 199 aa AA seqDB search
MAATVRKFRPVVISGPSGTGKSTILKRLFAEFPDKFSFSVSHTTRGPRAGEVDGREYYFT
SKEAFLNLVDEGGFIEYAQFGGNYYGTSTMAVKNISEKGRVCILDIEMEGVKQVKKTDLN
ARFLFLAPPSIEELERRLRGRGTETEDSLSKRLAQASNELEYAKQPGAHDKIVVNDDFDI
AYKSVRDWIVDNGNFGATL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccgctacagtgcgcaagtttcgccctgtggtgatttccgggccatcagggacgggc
aagtccacgatccttaagcggctctttgccgagtttcctgataagttcagcttctccgta
tctcataccacccgaggccctcgtgctggcgaagtcgatggtcgcgaatactactttaca
agcaaggaagcctttttaaatcttgttgacgaaggcggctttatcgaatatgctcaattc
ggtggcaattactatggaacgagcaccatggcggtgaaaaatattagcgaaaaagggagg
gtttgtatattggatattgaaatggagggagtcaagcaagtcaaaaagaccgaccttaat
gcccgattcctattcctcgcccctccatctatcgaagaactagagcgcagactccgtggc
cgcggaacagagacggaagatagcctcagtaaacggttggcgcaagcaagcaatgaacta
gaatatgccaagcagccgggagctcatgacaaaatcgtagtcaatgatgattttgacata
gcttacaagagtgtgagagattggatcgtggataatggcaattttggcgcaacactttga

DBGET integrated database retrieval system