KEGG   Coccidioides posadasii: CPC735_035240Help
Entry
CPC735_035240     CDS       T01332                                 

Definition
Guanylate kinase, putative
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cpw  Coccidioides posadasii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CPC735_035240
Enzymes [BR:cpw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CPC735_035240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 199 aa AA seqDB search
MAATVRKFRPVVISGPSGTGKSTILKRLFAEFPDKFSFSVSHTTRGPRAGEVDGREYYFT
SKEAFLNLVDEGGFIEYAQFGGNYYGTSTMAVKNISEKGRVCILDIEMEGVKQVKKTDLN
ARFLFLAPPSIEELERRLRGRGTETEDSLSKRLAQASNELEYAKQPGAHDKIVVNDDFDI
AYKSVRDWIVDNGNFGATL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccgctacagtgcgcaagtttcgccctgtggtgatttccgggccatcagggacgggc
aagtccacgatccttaagcggctctttgccgagtttcctgataagttcagcttctccgta
tctcataccacccgaggccctcgtgctggcgaagtcgatggtcgcgaatactactttaca
agcaaggaagcctttttaaatcttgttgacgaaggcggctttatcgaatatgctcaattc
ggtggcaattactatggaacgagcaccatggcggtgaaaaatattagcgaaaaagggagg
gtttgtatattggatattgaaatggagggagtcaagcaagtcaaaaagaccgaccttaat
gcccgattcctattcctcgcccctccatctatcgaagaactagagcgcagactccgtggc
cgcggaacagagacggaagatagcctcagtaaacggttggcgcaagcaagcaatgaacta
gaatatgccaagcagccgggagctcatgacaaaatcgtagtcaatgatgattttgacata
gcttacaagagtgtgagagattggatcgtggataatggcaattttggcgcaacactttga

DBGET integrated database retrieval system