KEGG   Coccidioides posadasii: CPC735_035390Help
Entry
CPC735_035390     CDS       T01332                                 

Definition
delta-aminolevulinic acid dehydratase, putative
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cpw  Coccidioides posadasii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CPC735_035390
Enzymes [BR:cpw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CPC735_035390
Exosome [BR:cpw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CPC735_035390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 373 aa AA seqDB search
MSFSTLVQDIAYRDSHPDDRSSILSRGGRTRSHASTAATSVSISGDISSQLHAGYSHPLN
RIWQAERQLTKSMLIYPLFITDVPDEETPIPSLPNQYRRGINRLVPFLTPLVKKGLRSVI
LFGVPLAPNAKDALGTAADDPAGPVIQTIRLLRAQFPQLYIVTDVCLCEYTSHGHCGILR
EDGTLNNALSIDRISDVALAYAEAGAHCVAPSDMNDGRVRAIKLKLIEAGIAHRVLLMSY
SAKFSGCLYGPFRDAAGSAPTSGDRKCYQLPPGGRGLARRAIQRDIAEGADIIMVKPAGS
YLDIISDAKELGRDMPVAAYQVSGEYAMIHAGAKAGVFDLKSMATESTEGILRAGAGIVV
SYFTPEFLDWLSS
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgtccttctcaacacttgtccaagacatcgcatacagagactcccatcccgatgaccgc
agctcaatcttgtcgagaggaggcaggactcgatcccatgccagcacggccgcgaccagc
gtaagcatttccggcgacatctcgagccagttacatgctggctacagccatccactgaac
cgcatctggcaagctgagaggcaattaaccaagtctatgcttatttaccccctcttcata
accgatgttcctgatgaagaaactcctatcccatccctaccaaatcaataccgtcgtgga
attaaccgtctcgttccctttctcacccccctggtaaagaagggccttcgttcagttatc
ctttttggggtcccacttgcccctaacgccaaggatgctctcggtacagcagcggatgac
ccggcaggcccagttattcaaaccattcgcctccttcgcgcacaatttcctcagctctac
atcgtaactgatgtctgtctgtgtgaatacacttctcatggccattgcgggattctgcga
gaggacggcacgttgaacaatgctctatccattgatcgaatttccgacgtggccctagca
tatgcagaagctggagcgcattgcgttgctccttccgacatgaatgatggtcgggtccgt
gccatcaaactcaaactaatcgaagctggcattgcgcatcgcgtgctcctcatgtcctac
agtgctaaatttagtggatgtctatatggaccgttccgcgatgcggcaggatcagctcct
acttctggcgaccgtaaatgttaccaactaccacctggtggccggggtctcgcccgtcgt
gcaattcagagagatatagccgagggtgcagatattatcatggtgaaaccggcaggtagt
tacctcgacatcattagtgacgccaaggaactaggtagggacatgcccgttgcggcatat
caggtcagcggtgaatatgcgatgattcatgcgggtgctaaagccggtgtgtttgatctg
aaatcaatggcaacagaaagtacagagggcattctgcgcgccggtgccggcatcgtggtg
agctacttcacaccagaatttttggactggctcagttcctga

DBGET integrated database retrieval system