KEGG   Coccidioides posadasii: CPC735_035390Help
Entry
CPC735_035390     CDS       T01332                                 

Definition
delta-aminolevulinic acid dehydratase, putative
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cpw  Coccidioides posadasii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cpw00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 373 aa AA seqDB search
MSFSTLVQDIAYRDSHPDDRSSILSRGGRTRSHASTAATSVSISGDISSQLHAGYSHPLN
RIWQAERQLTKSMLIYPLFITDVPDEETPIPSLPNQYRRGINRLVPFLTPLVKKGLRSVI
LFGVPLAPNAKDALGTAADDPAGPVIQTIRLLRAQFPQLYIVTDVCLCEYTSHGHCGILR
EDGTLNNALSIDRISDVALAYAEAGAHCVAPSDMNDGRVRAIKLKLIEAGIAHRVLLMSY
SAKFSGCLYGPFRDAAGSAPTSGDRKCYQLPPGGRGLARRAIQRDIAEGADIIMVKPAGS
YLDIISDAKELGRDMPVAAYQVSGEYAMIHAGAKAGVFDLKSMATESTEGILRAGAGIVV
SYFTPEFLDWLSS
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgtccttctcaacacttgtccaagacatcgcatacagagactcccatcccgatgaccgc
agctcaatcttgtcgagaggaggcaggactcgatcccatgccagcacggccgcgaccagc
gtaagcatttccggcgacatctcgagccagttacatgctggctacagccatccactgaac
cgcatctggcaagctgagaggcaattaaccaagtctatgcttatttaccccctcttcata
accgatgttcctgatgaagaaactcctatcccatccctaccaaatcaataccgtcgtgga
attaaccgtctcgttccctttctcacccccctggtaaagaagggccttcgttcagttatc
ctttttggggtcccacttgcccctaacgccaaggatgctctcggtacagcagcggatgac
ccggcaggcccagttattcaaaccattcgcctccttcgcgcacaatttcctcagctctac
atcgtaactgatgtctgtctgtgtgaatacacttctcatggccattgcgggattctgcga
gaggacggcacgttgaacaatgctctatccattgatcgaatttccgacgtggccctagca
tatgcagaagctggagcgcattgcgttgctccttccgacatgaatgatggtcgggtccgt
gccatcaaactcaaactaatcgaagctggcattgcgcatcgcgtgctcctcatgtcctac
agtgctaaatttagtggatgtctatatggaccgttccgcgatgcggcaggatcagctcct
acttctggcgaccgtaaatgttaccaactaccacctggtggccggggtctcgcccgtcgt
gcaattcagagagatatagccgagggtgcagatattatcatggtgaaaccggcaggtagt
tacctcgacatcattagtgacgccaaggaactaggtagggacatgcccgttgcggcatat
caggtcagcggtgaatatgcgatgattcatgcgggtgctaaagccggtgtgtttgatctg
aaatcaatggcaacagaaagtacagagggcattctgcgcgccggtgccggcatcgtggtg
agctacttcacaccagaatttttggactggctcagttcctga

DBGET integrated database retrieval system