KEGG   Coccidioides posadasii: CPC735_035440Help
Entry
CPC735_035440     CDS       T01332                                 

Definition
protein disulfide-isomerase precursor, putative
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
cpw  Coccidioides posadasii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CPC735_035440
Enzymes [BR:cpw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CPC735_035440
Exosome [BR:cpw04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CPC735_035440
  Exosomal proteins of colorectal cancer cells
   CPC735_035440
  Exosomal proteins of bladder cancer cells
   CPC735_035440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 523 aa AA seqDB search
MYQLRHLALGLAGICFATSAFAADDESSVKSLKADNFKDFITQHDLVLAEFFAPWCGHCK
ALAPEYELAASELKEKNIPLVKVDCTEEAALCEEYGVEGYPTLKVFRGLESTKPYNGARK
SQSIVSFMIKQSLPAVSKVTSDTFETIKGLDKIVVVGYFKEDDKASNETFTSIAEALRDE
YLFAGTNDATLAEAEGVSQPAIVLYKDFDDRKDIFVDKFDKEAITHFVKTASTPLVGEVG
PETYSGYMAAGIPLAYIFAETLEEREQFAADLKPLARKLKGAINFATIDAKAFGAHAGNL
NLDPEKFPAFAIQDTVKNTKFPYDQTKKIDEKDISQFVQDVLDGKIEPSIKSEPVPESQE
GPVTVVVGHSYEDIVKNNDKDVLLEFYAPWCGHCKALAPKYEQLASLYANNPEFSSKVVI
AKIDATANDVPDEIQGFPTIKLYPAGSKDSPVEYRGTRTVEDLANFIRDNGKYHVDAYVK
GQVEEGGDVTGKPKTETVASTASTESGTPASSKQAEATVHEEL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgtaccagttgcgccatctcgcccttggcctggcgggcatctgctttgcaacttccgcc
ttcgcggctgatgacgagtctagtgtcaaatccctaaaggctgataatttcaaagatttt
attacgcaacacgacctcgtcctcgcggagttctttgcgccatggtgtgggcattgtaaa
gcccttgccccagagtacgagttggctgcgtctgagttgaaggagaagaatatcccgctt
gtcaaagtggactgcactgaagaagccgcgctgtgtgaagaatatggcgttgaaggctat
cccacactgaaggtattccgcggcttggagtcaacaaagccctacaatggtgctagaaag
tcgcaatcgattgtatcctttatgatcaaacagtctctacctgctgtgtctaaggtaaca
tctgatacctttgaaactatcaaaggcctagacaaaatagtcgttgttggatatttcaaa
gaggacgataaggcatcaaatgagaccttcacctccattgctgaagcgttacgcgatgaa
tatctttttgcaggcaccaatgatgctacattggcggaggctgagggtgtctcacagcca
gcaattgtcctatataaggactttgatgatcgcaaggacatttttgtcgataaattcgac
aaagaagcaataactcacttcgtcaaaactgctagcactcctcttgtcggcgaagttgga
cctgaaacatattctggctacatggctgcagggattcctcttgcttatatctttgcagag
acgctggaagaacgtgagcaattcgctgcagacctgaagcctctcgctagaaagctaaag
ggcgctattaattttgctaccattgatgcgaaagcttttggagcgcatgctggaaatctc
aatcttgaccctgagaagtttccagcatttgctattcaggatactgtgaagaacacgaaa
tttccttatgaccagaccaaaaaaattgatgaaaaagacatcagccaattcgtccaggat
gttcttgatggaaaaattgaacccagtatcaagtctgaaccagtacctgaatcccaagaa
gggcccgtcactgtcgtggttggtcactcatacgaagacatcgtgaaaaacaacgacaag
gatgtattgttggagttttacgccccatggtgtgggcactgcaaggccctcgcacctaaa
tatgaacagctagcttcgctttatgcgaataatcccgaattttcttcaaaggtcgtcatt
gcaaaaatagatgctactgcgaatgatgtacccgatgaaattcaaggctttcctacgata
aaactttaccctgccggttcgaaggattctcctgtggaatatcgcggaacgagaactgtt
gaagatcttgcgaactttatccgtgataatggaaaatatcatgttgatgcttatgtcaag
ggacaagtggaggagggaggcgatgttactggcaaaccgaaaactgagaccgtcgcgtcc
actgcttcaacggagagtggaacacctgcttcttcgaagcaagctgaggccacagtacat
gaagaactgtga

DBGET integrated database retrieval system