KEGG   Coccidioides posadasii: CPC735_035470Help
Entry
CPC735_035470     CDS       T01332                                 

Definition
Ubiquitin carboxyl-terminal hydrolase family protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
cpw  Coccidioides posadasii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 789 aa AA seqDB search
MVCPHVDSAGLQPPRNSQSVYREDCTQCFDSIDDPSGLNVCLSCFNGGCTGNRDHAALHH
ARCQHPLALNIRRTRKPIQRDEPPPKISKLAIKPLREEDHYNTTIKVICYDCHNDDVDIS
SIPVLQDVIDGVMNTLTFSRKEEVKAWELELTSCEHILCLTQDDASLMQLNKFSHCSQCS
MQENLWLCLQCGNVGCGRSQFGGMGGNSHALAHASNLTHSVSVKLNSISPEGSADVFCYA
CNEERIDPDLALHLAHWGIMITEQKKTEKSLTEMQIEQNLKWEFTMTSSDGMDLKPIFGP
GLTGLRNLGNSCYLASALQCLFSLPEFEYRYFKPQELPPVVPLPAEDLETQLRKIADGLI
SGRYSVPNSDTVAHTGCQDLPHQLGLAPGMLKHLIGRGHDEFSTMRQQDAFEFLLHLFKL
INVNKHYDTPNPVASFRFNLEQRLQCLSCGKVRYKIDEQDNISVPVPIRRLKEDNDAESC
ASGETPVSSKFDRVSLRECLDIFTAEEIVELTCSGCESKKGFRKRSLFKTFPQNLIINAR
RFELINWVPTKLNIPVEVSDEPLDLSQYRSLGIQAGEILLEDEPSPLDIEFQPNEAAVAM
LLSMGFPEIRIKKALYATGNTDTDAALNWLLSHMDDPDIDATDISAPPGSGGNHCSHEDE
AKIGQLIDMGIDRPKARKALLETDGDINRALDWVLSHPYDAEIEGYQVSSGSPAQLQGSS
DIPALFQLHAIICHKGVSVHTGHYVAFVRKEVAQDEDSQWVLFNDEKVVQGGDIEEMKQF
AYIYFFRKL
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgcccgcatgtggattcggcagggctgcaacctcccagaaacagccaatctgta
tatcgggaagattgcacccaatgttttgactctatagacgatccatctgggctgaatgtc
tgcctcagctgctttaatggaggttgtacggggaacagagatcatgctgcccttcaccat
gctcgctgtcagcacccattggccctaaatattaggagaacgcgcaagccaatacagcgt
gatgaacctccccctaaaatatcgaaattagcgatcaagcccttaagagaagaagatcat
tataacaccactatcaaagtaatatgttatgattgccacaatgatgatgttgatatctct
tctatcccagtgttgcaggatgtgatagatggtgtcatgaacaccctcacattctctcgc
aaggaagaagtaaaggcatgggagcttgaacttacatcatgtgaacatatcctgtgtctc
acccaggatgatgctagtttaatgcaacttaacaaattttctcattgttctcagtgttcc
atgcaagaaaatctttggctatgcttacaatgtggcaatgttggctgtggtcgcagtcag
tttggaggcatgggaggcaattcccatgcacttgcacatgcttctaatttgacacattct
gtctcggtcaagttaaattcgatctctcctgaggggtctgctgatgtattctgttatgcc
tgcaatgaggaacgaattgacccggatctagctttgcacctagcacactggggaattatg
atcactgagcagaaaaaaaccgagaaaagtctcacggaaatgcagattgagcaaaacctt
aaatgggagtttacaatgacttcaagcgatgggatggacctaaagcctatctttgggcca
ggactcaccggcttgcgaaacctcggcaacagttgctaccttgccagtgctctccagtgc
ttgttctccctaccggagtttgaataccgatattttaaaccacaagagcttcctccagta
gtacctttaccggcggaggatctcgaaactcaactaaggaaaatagccgatgggcttatt
tcaggccgttactctgtcccaaactccgatacggtggcccacacgggctgtcaagaccta
cctcatcagttagggctagctccaggaatgctaaaacatttaattggtcgcggtcatgat
gaattttcgacaatgcgccagcaagatgcgtttgaatttcttctgcacctttttaaactt
ataaatgtcaataaacattatgacactcccaatccagttgcatcttttcgttttaatttg
gagcagcggttacaatgcctatcatgtggaaaggtgcgatataaaattgacgaacaggat
aatatttctgttcctgtgccaattcgtcgcttgaaagaagacaatgatgctgagagttgc
gcaagcggagaaacaccggtatcttcgaaatttgaccgtgtctctctcagggaatgcctc
gatatttttactgcagaagaaattgtcgagttaacgtgttctgggtgcgaaagcaagaag
ggcttccgaaagcgatcgctcttcaagacatttccgcaaaacttgattattaacgctaga
cggtttgaactgatcaactgggtgccaactaaacttaatatccccgtcgaagtgagtgac
gaacccttggatctcagccaatatcgctcgcttggcattcaggcaggcgaaattttatta
gaagatgagccctcacccctagatatcgagtttcaacccaatgaagcagcggttgccatg
cttctcagtatggggtttcctgagattcggatcaaaaaggcactctatgccacaggaaat
acggatacggatgccgcgttgaattggttgctttcacatatggatgatccggatatcgat
gcgacggacatttccgcaccaccaggtagcggtgggaatcactgttcacatgaagacgaa
gcaaagattggtcaactaattgacatgggcattgatcgcccgaaagctcggaaagcgctc
cttgaaacggatggagatatcaacagggcgttggattgggttttaagtcatccgtatgac
gcggagatcgagggatatcaagtaagcagtggatccccagcgcagttgcaaggatctagt
gatatacctgctctctttcaattacacgccatcatctgccacaaaggtgtctcagttcat
actggtcactatgttgcatttgtccgaaaagaagttgcccaggatgaagacagccaatgg
gttcttttcaatgatgaaaaggttgttcaaggtggtgatattgaggagatgaagcaattc
gcatacatctattttttcagaaaattatag

DBGET integrated database retrieval system