KEGG   Coccidioides posadasii: CPC735_036660Help
Entry
CPC735_036660     CDS       T01332                                 

Definition
Calcineurin B subunit, putative
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cpw  Coccidioides posadasii
Brite
Protein phosphatases and associated proteins [BR:cpw01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     CPC735_036660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 191 aa AA seqDB search
MTEQDNNAESYDATKRQQTSSSSQVINDIVSGSNFDHEEVDRLWKRFMKLDRDKSGTIER
DEFLSLPQVSSNPLSTRMIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEEKLRFAFKVYD
IDRDGFISNGELFIVLKMMVGSNLKDMQLQQIVDKTIMEADLDGDGRISFEEFTRMVENT
DVSMSMTLDQF
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaagacaacaatgcagaatcatatgacgcaacaaagcggcagcaaaccagt
tccagctcgcaagtcataaatgatattgtgtcaggatctaattttgatcatgaagaagtt
gacaggctgtggaaacgctttatgaagttggatagagataaatctggcactatcgagcgt
gatgaattcctttccctcccacaagtctcttcgaacccgctttcaacccgaatgatagcc
atctttgacgaagacggcggtggtgatgtcgatttccaagaatttgtgtccggcctatca
gcgttcagctcaaagggcaacaaagaggagaaactccgtttcgcattcaaagtatacgat
atcgaccgcgacggttttatttccaacggagaattgttcattgtattgaagatgatggtg
ggaagtaatttgaaggatatgcagctacagcagattgttgacaagacgatcatggaagct
gatttggacggcgacgggagaataagtttcgaggaatttacaaggatggtggaaaataca
gatgttagtatgagtatgacattggatcaattctaa

DBGET integrated database retrieval system