KEGG   Coccidioides posadasii: CPC735_037740Help
Entry
CPC735_037740     CDS       T01332                                 

Definition
Dolichyl-phosphate-mannose--protein mannosyltransferase 2, putative (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cpw  Coccidioides posadasii
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:cpw00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 747 aa AA seqDB search
MASNETAFATGASSSADIRRRNVPGSEKANGGSGVPEIVVDGKKAFAKKSSFLDVLDEWE
FLIAPVIFTALAFFTRMWRIGLSNIVTWDEAHFGKFGSHYIKREFYFDVHPPLGKMLVGL
SGYLAGYNGSFEFKSGEKYPEELNYTFMRIFNAFFGVVCVPLAYFTARELNFRRATVWLV
TLMVLFENSYATISRFILLDSMLLCFTFTTVFCWARFHRFQNQSFSCEWFIWLFLTGISI
GCVCSVKMVGLFCTALVGLYTIEDLWNKFGDLKMPKTVLAQHLVARIIALILVPLAVYMF
SFYIHFLVLENSGPGDAQMSSLFQANLRGTTVGKDSPLEIAIGSKVTIKNMGYGGGLLHS
HVQTYPSGSSQQQVTCYHHKDSNNDWFVYPNRTQPDYDPEGELRFIGDGDIIRLIHAQTG
RNLHSHAIPAPITKSSWEVSCYGNTTVGDDKDHWVVEVVNDVASKDRSKIRTLTTAFRLR
HSSLGCYLRAGNVNLPQWGFKQIETTCVKENKPYDVHTHWNVESHVNERLPKGDPGAYKS
PFLKDFIHLNVAMMTSNNALVPDPDKQDDLASKWWQWPVLNVGLRMCSWDNDTVKYFLLG
NPFVYWGSTASLAVFGLVVAWYLVRWQRGYTELSQADIDHIHYSGIYPLLGWVLHYLPFI
IMARVTYVHHYYPALYFAILTMGFCVNWFTQNLSKPAEWAVYFVLYAAVISLFVVFKDIV
FGMQGSNEQWQYLNWLSTWRIANPTSS
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcaatgagactgcgttcgctacaggtgcgtcttccagcgcagacattcgaagg
agaaatgttcccggttcggagaaggccaatggcgggtctggtgtacccgagattgtggtg
gatggcaagaaagcttttgcaaagaaatcgtccttcctagacgtcctcgatgagtgggaa
tttcttattgcaccagtaatatttaccgctttggcattcttcactcgcatgtggcgcatt
ggcctgtcgaacattgtgacatgggacgaggctcactttggcaagttcggttctcactat
atcaaacgggagttttatttcgacgtgcatcctccgctgggtaaaatgcttgttggtctc
tctggatatttggccgggtataacggatctttcgaattcaagtctggcgaaaagtaccct
gaggaactcaattataccttcatgcgaatattcaatgcgttttttggtgtggtatgcgtg
ccattagcttactttaccgcccgagagctcaatttccgtcgggcaaccgtctggcttgtt
acgttgatggtcctcttcgaaaactcctacgcaacgatttctcgatttattctcctggat
tcgatgcttttgtgcttcaccttcacaacagttttttgctgggctcgattccaccgattt
cagaaccaaagcttctcatgcgaatggttcatatggttgttcttgactggtatcagcatc
ggatgtgtctgcagcgtgaagatggttggcttgttttgtactgcgttggttggactttac
actatcgaggatctatggaataagttcggcgacttgaaaatgccaaagaccgtccttgcc
caacaccttgtggctcgtatcattgcacttatccttgtgccgttggccgtatacatgttc
tctttctacattcatttcctcgtcctcgaaaactccggccccggcgatgctcagatgagc
tcacttttccaggcgaacctgagaggaaccactgtcgggaaggacagcccattggagatt
gccattggatccaaggttaccataaagaacatgggatatggtggtggtttacttcattcc
cacgttcaaacctatccctcgggctcttcgcaacaacaagttacatgctatcaccacaag
gactcgaataacgattggttcgtttatccaaaccgcactcagcccgattatgatcccgag
ggcgaactcagatttatcggggacggtgacattattcgccttatccatgcccaaaccggc
cgtaatttacactctcatgctatccccgctccaatcaccaagtccagctgggaagtttct
tgttatggaaacacaactgttggcgatgacaaagaccactgggtagtggaagtcgttaat
gatgttgcttctaaagatcgatccaagatccgaaccctcactacggctttccgcctccgc
cactctagcctaggatgctatttacgtgctggcaatgttaatttgcctcagtggggtttc
aagcagattgaaaccacctgtgtgaaggagaataagccctatgatgttcacacgcattgg
aatgttgaatctcacgtcaacgagagactgccgaaaggtgatcctggtgcctacaagtcg
ccattcttgaaagatttcatccatctgaatgttgccatgatgacttcgaataatgctctt
gttcccgacccagataaacaggatgatctggcttccaagtggtggcagtggcctgttctc
aatgtcgggctccgcatgtgttcgtgggacaatgacaccgtcaaatacttcctcctcggc
aacccttttgtgtattggggcagcacagccagcttagctgtcttcggcttggtggttgcc
tggtacctcgtccgctggcaacgcggttacaccgagctgagtcaggcagatatagaccac
atccattactctggtatctatcctctccttggatgggttctccactaccttccattcatc
atcatggcccgcgtcacctatgtgcaccattactatccggcactctactttgcgattctg
acaatgggattctgcgtcaactggttcacccaaaatctcagcaagccggctgaatgggcg
gtttactttgtcctatatgccgctgtcatctccctctttgttgtattcaaggacattgtc
tttggaatgcagggatcaaacgagcagtggcagtatctcaactggctcagcacttggcgc
attgctaacccgacatcgtcttaa

DBGET integrated database retrieval system