KEGG   Coccidioides posadasii: CPC735_038230Help
Entry
CPC735_038230     CDS       T01332                                 

Definition
Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial precursor, putative (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cpw  Coccidioides posadasii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:cpw01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cpw00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cpw00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 484 aa AA seqDB search
MKGYTSMLRSMSPRLQFSPAISRTSNQLLRQRTCQQQSRQIRLLSYSRVYSNSGKASHLS
QSGLWRSSQCLRRNILRPIPSQLNSCQLRFYADTIVKVPQMAESISDGTLKQFSKQIGDF
VERDEELATIETDKIDVTVNAPESGIIKEFLAKEEDTVTVGQDLVKLQPSTENPSSGKDK
LQENTQSAELKVREEQPQEQPNRRERGESAQVTQQQPSPKEEKPAPKVERESPKESQLMA
NAAHGSVGNRDERRVKMNRMRLRIAERLKQSQNTAASLTTFNEVDMSSLMEFRKLYKEDI
LKKTGIKLGFMSAFARACVLAMKEVPAVNASIEGPNGGDTIVYRDYVDISVAVATEKGLV
TPVVRNVENMDLTTIEKAIADLGQKARDNKLTIEDMAGGTFTISNGGVFGSLMGTPIINL
PQTGVLGLHAIKNRPVAVNGKVEIRPMMYLALTYDHRLLDGREAVTFLVRVKEFIEDPRR
MLLG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggttacacatcaatgttaagaagcatgtctcctcgccttcaattcagtcctgcg
atctcgcgcacctcaaatcaattgctcagacaaaggacctgtcagcaacagtcgcgtcaa
attcggttactctcatactcaagggtatattcaaacagcggcaaagcttcacatctctcc
caatccggactttggcgttcctcgcaatgcttaaggcgaaatattttgcgaccaattcca
tcgcaattaaatagttgccagctacgcttctacgctgataccatcgttaaagtccctcag
atggcggaatcaatttcagatgggaccctgaaacaattttcaaagcagatcggggacttc
gtagagcgggatgaagagctcgccacgatcgaaactgacaagatcgatgttaccgtgaat
gcaccggaatccgggataatcaaagaatttctagcaaaggaagaagacaccgtaactgtt
ggtcaagacctcgtcaaactacaaccgtcgacagaaaatccgagctccggaaaggacaaa
cttcaggaaaacacgcaatccgcggagctcaaagtgcgagaggaacaacctcaggagcaa
ccgaacagaagagagaggggagagtcggcccaggttacccagcaacagcccagtccaaag
gaggagaagcccgctcctaaagtagaacgagagtctccaaaagaatcccagctaatggct
aatgccgcccatgggagcgttggcaacagagacgagcgcagagtaaaaatgaaccgcatg
cgactacgaattgccgagcgtctcaagcaatcccaaaacactgcagcatctctaacaacc
ttcaacgaagttgatatgtcatcgcttatggaattccgcaagttatataaagaggacatc
ctgaagaaaaccggtatcaagcttggattcatgagtgcgttcgcgcgcgcgtgtgtattg
gccatgaaggaagtaccggctgtgaatgcctccattgagggaccaaatgggggagacaca
attgtataccgagactatgttgacattagcgttgcggttgcaactgagaaaggcctggta
acccccgttgtgcgaaatgtcgaaaacatggaccttactacgatcgagaaggccatcgct
gatctagggcagaaggctcgagacaataaattgaccatcgaggacatggctggcggcacc
ttcactattagcaatggaggtgtttttggctcattaatgggcactcctatcatcaatctt
ccgcaaacaggagttcttggtcttcacgcaataaagaataggcctgtggcagtcaatggg
aaagttgaaatcagacctatgatgtatcttgccttgacttatgatcaccgcctcctcgac
ggcagagaagctgtcacatttttagttcgagtcaaggagttcattgaagatccaaggcgc
atgttactggggtaa

DBGET integrated database retrieval system