KEGG   Coccidioides posadasii: CPC735_038260Help
Entry
CPC735_038260     CDS       T01332                                 

Definition
Histone H2B, putative
Orthology
K11252  
histone H2B
Organism
cpw  Coccidioides posadasii
Brite
Exosome [BR:cpw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CPC735_038260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 139 aa AA seqDB search
MAPKAAEKKPSTGGKAPAGGKAPAEKKEAGKKTAASGEKKKRTKARKETYSSYIYKVLKQ
VHPDTGISNRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGELA
KHAVSEGTKAVTKYSSSAK
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggccccaaaagctgctgaaaagaagccaagcactggcggaaaggctcccgccggcggt
aaagcacccgctgaaaaaaaggaagctggcaagaaaacggctgcttcaggcgagaagaaa
aagcgaactaaggctcggaaggaaacgtattcttcatatatttacaaagtcctcaaacaa
gtccatccggacactggtatctctaaccgcgcaatgtctatcctaaattcttttgtgaat
gatatctttgaacgcgtcgccactgaagcatcaaaacttgctgcatataacaagaagtcc
acgatttcttcacgggaaatccaaacctctgtgcgcctaattctaccaggagaactcgcc
aagcatgctgtttctgaaggcaccaaagctgtcacaaaatattcttcttctgccaaatag

DBGET integrated database retrieval system