KEGG   Coccidioides posadasii: CPC735_038300Help
Entry
CPC735_038300     CDS       T01332                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
cpw  Coccidioides posadasii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 413 aa AA seqDB search
MADCPKHHCLYSRESRTPNYTIFGGPISSSGQLHKPLWHGFCEIESEPALFNVMLRDWGV
KGVKVQEVVSLDNDMLQFLQPIYGLVFLFRWREDDPVKQEQSCPEGLWFANQTVNYACAS
VALLNIINNIEGVELDEELRSFKEFTMDFTPALRGDAIRNFAFIKEIHNSFARKMDILNV
DLQLKNDASKKRSKLCRKDQGFDESEAGFHFIAFVPARGKVWKFDGLERQPQNLGDYSDE
DWLELAKPEIQSRMAEYEEGQIEFSILSLAKDPMIGLVDQLAMNVKRLVFIDELLCNLPD
IQGFGSLDNAIVTGPDPSFNLTSSTLEKAVVSEIDMQSYTNMSKERLLEAQKTLIDAQKE
ICVAIKEEQQVREADNTYAEKKRHDYGPAVYSWLRALARKGLIEHLARDTPPP
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggcagactgcccaaaacatcattgcctttactctagagaatctagaaccccaaattac
actatatttggtggccctatttcatcatccgggcagcttcacaagcccttgtggcatgga
ttttgcgagattgaatccgaaccagcccttttcaatgttatgctaagggactggggtgtg
aaaggtgtcaaagtccaggaagtcgtctctcttgacaatgatatgctgcaatttttacaa
cccatctatggactagtatttttgttccgttggcgagaggatgatccagtaaaacaagaa
caaagttgtcctgaaggtctgtggtttgcaaatcagacagtgaattatgcctgtgctagt
gttgcactgctcaatattatcaataatattgaaggagtagaacttgatgaggagctccgt
tccttcaaagaattcacaatggatttcactccagcgctgcgcggtgatgctataaggaat
tttgcattcattaaggaaatacacaactcgtttgcaaggaaaatggacattctaaatgtt
gacctccaactcaaaaatgatgcgtctaagaaaagatccaagctttgcagaaaggaccaa
ggctttgatgaatcagaggcagggttccatttcattgcctttgtacccgcaagggggaag
gtatggaaattcgatggattagagcgccaacctcaaaatcttggagactattccgacgag
gactggctggaacttgctaaacccgaaatccaatcgagaatggctgagtatgaggaaggc
caaattgaattctcgattctcagtttagccaaagatccaatgattggcctagttgatcaa
ctcgcgatgaatgtgaaaagattggtctttatcgatgagttactatgcaatttgcccgat
attcaaggctttggttcccttgacaatgccattgtgaccggccccgatccgtcattcaat
ctgacatcgtccaccttagaaaaggcggttgtgtccgaaatcgatatgcaaagctatacc
aacatgtcgaaggagcgtctgctagaagctcagaaaacacttatcgatgcccagaaggaa
atatgtgtggcgattaaagaagaacagcaagtacgcgaggcggataatacttatgcagaa
aaaaagcggcatgattacggcccggcagtctacagctggcttcgtgcgttagctcgaaag
gggctaattgaacatttggcgagagatacgccaccgccttga

DBGET integrated database retrieval system