KEGG   Coccidioides posadasii: CPC735_040420Help
Entry
CPC735_040420     CDS       T01332                                 

Definition
Calmodulin, putative
Orthology
K02183  
calmodulin
Organism
cpw  Coccidioides posadasii
Pathway
Phosphatidylinositol signaling system
Class
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:cpw04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 149 aa AA seqDB search
MADSLTEEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN
NGTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDD
EVDEMIREADQDGDGRIDYNEFVQLMMQK
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggctgattcattgaccgaagaacaagtttctgagtacaaggaggccttctctctgttt
gacaaagatggcgatggtcagatcaccaccaaggaactcggaaccgtaatgcgttccctc
ggccaaaacccttccgaatctgaattacaggatatgatcaacgaggttgacgccgataac
aatggaaccatcgatttcccggagttccttaccatgatggcacggaaaatgaaggatacc
gattccgaagaagagattcgggaggcgttcaaggtctttgaccgggataacaacggcttc
atctccgccgcagagttgcgccacgtaatgacctccatcggcgagaagttgaccgatgac
gaagtggatgagatgatccgtgaggccgaccaggatggtgatggaagaatcgactataac
gaattcgtccaacttatgatgcagaaataa

DBGET integrated database retrieval system