KEGG   Coccidioides posadasii: CPC735_040420Help
Entry
CPC735_040420     CDS       T01332                                 

Definition
Calmodulin, putative
Orthology
K02183  
calmodulin
Organism
cpw  Coccidioides posadasii
Pathway
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    CPC735_040420
Protein phosphatases and associated proteins [BR:cpw01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     CPC735_040420
Exosome [BR:cpw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CPC735_040420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 149 aa AA seqDB search
MADSLTEEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN
NGTIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDD
EVDEMIREADQDGDGRIDYNEFVQLMMQK
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggctgattcattgaccgaagaacaagtttctgagtacaaggaggccttctctctgttt
gacaaagatggcgatggtcagatcaccaccaaggaactcggaaccgtaatgcgttccctc
ggccaaaacccttccgaatctgaattacaggatatgatcaacgaggttgacgccgataac
aatggaaccatcgatttcccggagttccttaccatgatggcacggaaaatgaaggatacc
gattccgaagaagagattcgggaggcgttcaaggtctttgaccgggataacaacggcttc
atctccgccgcagagttgcgccacgtaatgacctccatcggcgagaagttgaccgatgac
gaagtggatgagatgatccgtgaggccgaccaggatggtgatggaagaatcgactataac
gaattcgtccaacttatgatgcagaaataa

DBGET integrated database retrieval system