KEGG   Coccidioides posadasii: CPC735_041360Help
Entry
CPC735_041360     CDS       T01332                                 

Definition
kinase domain containing protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
cpw  Coccidioides posadasii
Brite
Enzymes [BR:cpw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CPC735_041360
Protein kinases [BR:cpw01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   CPC735_041360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 914 aa AA seqDB search
MDPQWPAYSDSAGSRANQFGNGHPSQMSQKYTVPGPGAQSQMQQPQAPLGYTYETYQSPT
ATNPPPLPSNAKSVSMTSSPTATPLTREYIDPDTPMEDADPYNRSKYPTRSSQQNRPSSQ
YLSSEESSVARKYSPMNITSPAVPYNASPNTSQGSYSFQAGNSSSRPSPTRTNAFSASSQ
NFQSPSSGAPSRPQAPRLPPMQTTDISPEQYYPQSATLQLHTAFGQNSKTQPARPSHLNQ
SSSALETSARRGPVPRFQKIKSTQELKPKVNAQPAFRRANPEGGFISPLQALTTHLPATY
RICNPTFKYESSRNPRRVLTKPSKGTKNDGYDNDDSDYILYVNDILGSEEANHKNRYLIL
DVLGQGTFGQVVKCQNLKTQEVVAVKVVKNRTAYFNQSMMEVSVLDLINSKLDKNDDHHL
LRLKDTFIHRQHLCLVFELLSVNLYELIKQNQFRGLSTTLVRVFAQQLLNGLALLNKARL
IHCDLKPENILLKNLESPIIKIIDFGSACDERQTVYTYIQSRFYRSPEVLLGLPYSSAID
MWSLGCIVVELFLGLPLFPGSSEYNQVSRIVEMLGMPPTWMIEMGKQAGEFFEKTQDEFG
RRSYRLKSLEQYSREHNTKEQPSKRYFQSNNLSEIIRNYAMPRKNMKQAEIDRELNNRVA
FTDFVRGLLTINPLERWSPQQAKLHPFITQQKFTQPFVPPMNLKSSVINKSVAPGVQQQQ
QAEAASKQRAAQEAQVHAQAQSAAQSAYAMQMNPYNPASHSQPPTVYNNMYPGHQQGAPP
PYPAQQSGYGHQMGMMQSPSHIPQQPYGASQSLYAQATTRAGRQRASTMDQQQSGIPPAI
QRVASHLDPNAPIRLQPSPAYYPPPADGYSEGNASGTRRRGSRVGGNHGRGRDFIRTLED
GALGDGFVAQNQWR
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggatccgcagtggcctgcttactccgattcggcgggaagcagggctaatcaattcgga
aatggccatccgtcgcaaatgtcccagaagtatacagttcctgggcccggagcccaaagt
cagatgcaacaaccgcaggctccgttgggttacacctatgaaacgtaccaaagcccgacc
gctacgaatcctccccctctgccttcgaatgccaaatcggtttccatgacctcgtcgccc
actgcgaccccgcttacgcgggagtatatcgacccggatacgccgatggaagatgcagat
ccgtataataggtcaaaatatcccaccaggtctagccagcagaaccgaccctcttctcaa
tatctttcgagtgaggagtcctcggttgccaggaaatactcccctatgaacatcacttcg
ccggcagtcccctataacgccagtccaaacacttcgcaaggttcatactccttccaagca
ggtaattcgagctcgcgaccatcccccacaaggacgaacgctttctctgcgtcgtctcaa
aatttccagtccccatcatctggtgctccatcgagaccccaagctccacgattaccccca
atgcaaaccacggatatcagtccggaacagtactacccgcaatcggccaccctccaactc
cacacggcattcggacagaactcaaaaacgcaacccgcccgaccgtcgcacttgaaccaa
tcgagctccgccttggaaacgtcggctagaaggggccctgtgcctagatttcaaaagatc
aagtccacgcaagagctgaagccgaaagtaaatgcgcagcctgcctttcgtcgtgcaaat
cccgagggggggttcatcagccctctccaagctctcacaacgcatttacccgctacgtac
cgaatatgtaacccaacgtttaaatacgagtcgtccaggaatccccgacgagtgctaaca
aagcccagcaagggaaccaagaatgatggctatgacaatgatgacagtgactatatcctc
tatgtcaatgacattcttggcagtgaggaggcaaatcataagaaccggtaccttattctt
gatgtgcttggacaaggcacgtttggtcaggtggtgaagtgccagaacttgaagacccaa
gaagttgttgctgtcaaggttgtgaaaaatcggacagcatattttaatcagagcatgatg
gaagtttcagttcttgacctgatcaatagtaagctggacaagaacgatgatcaccatctt
ttgcgcctaaaagataccttcatacatcgacaacatctatgcctggtttttgagcttcta
agtgtgaatctctatgaactcatcaaacaaaatcaattccgtggacttagcacaacatta
gttagggtttttgcgcagcaacttctaaatgggttagcattactcaacaaagctcggctc
attcactgtgacctcaaaccagaaaatattcttttgaagaacctcgaaagtccaatcatc
aagatcatagattttggttctgcttgtgatgaaaggcagacagtctatacttatattcaa
tcccgattttatcgttcacctgaagttcttttaggccttccatattcatctgctattgac
atgtggtcattaggttgtattgttgtcgagcttttccttggtttgccattatttccggga
tcctccgagtacaaccaggtttctagaatagtagaaatgctgggcatgccgccaacatgg
atgatcgagatgggaaagcaagccggcgaattctttgaaaaaacccaagatgaatttggg
agacgaagttataggcttaaaagccttgaacagtactcgcgtgagcacaacaccaaggag
cagccgagcaagagatatttccagtcgaacaacttgagtgaaatcattcgtaactatgcc
atgccaaggaagaatatgaagcaagcagaaattgatagagagttgaacaatcgcgttgca
tttactgattttgttcgtggactattgacaatcaatcccctagaaaggtggtcgccgcag
caagcaaagttgcaccctttcattactcagcaaaaattcacacagccatttgtgccgcct
atgaacttgaaatcctctgttatcaacaaatctgttgcgcccggtgttcagcagcagcaa
caagccgaggccgctagcaaacaacgtgcggcacaagaggcacaagtacacgcacaggcc
caatctgcagctcagtctgcatatgcaatgcaaatgaatccatataacccggcttctcac
agtcaacctccgacagtgtacaacaacatgtaccctggtcatcaacaaggtgccccaccc
ccttatccggcgcagcaatcaggatatggacaccagatgggaatgatgcaaagtccttct
catattccgcaacaaccatatggagcttcccagagcctttatgcccaagcaacaacgaga
gctggacgacaaagagcttccactatggatcagcaacagagtggtatccctcctgcgatt
cagagggttgccagtcatttagatccaaatgctccgattcgcttgcaacccagcccagct
tattatcctccaccggcggatggatattctgaaggaaatgcatctgggacgcgtcggaga
ggcagccgtgtcggtggaaaccatggtcggggtcgagattttattcgcaccctcgaagac
ggtgcacttggtgatggatttgtggcccaaaatcaatggcgatga

DBGET integrated database retrieval system