KEGG   Coccidioides posadasii: CPC735_041780Help
Entry
CPC735_041780     CDS       T01332                                 

Definition
dihydropteroate synthase family protein (EC:2.5.1.15)
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
cpw  Coccidioides posadasii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cpw00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 589 aa AA seqDB search
MRNTIPCFVVDTTVLLCSTRLSPSFSPSIGRQCVKSNTYDRFPLAHKNISTLSSKLQFAD
VGYSCTLTRDFDSHAYRSHGRNPLRRDYSTPAFLQRHKTIIALASRSVQTHYCSSYMSPD
GAGNTANMAVSSQHRAFIALGSNMGDRVAMIEQACMEMEARGIRIMRTSSLFETAPMYVT
NQDPFINGVCEVETNMHPIELLDTLQSIEIAMGRRKIVDKGPRVIDLDILLYGEEVFSNE
RLNIPHKLMLEREFVLRPLCQLIPESIPPSSKDSNCYQTYLDALPSSDPAPQAITPMHTN
MPPLNPSNPKRHTHIMAVLNVTPDSFSDGGLHSAADASTLTQTTRYFINNGATIIDIGGE
STRPSSDPTTEQDELSRTIPAIKLIRSLPEADHIAISIDTYRASVAQAAVAAGADIINDV
SAGLMDPEMLPTMARLGKTVILSHMRGTPKTMTKLTDYPSGVIDGVSTELAQRIAAAEAA
GVRRWRIIADPGVGFAKNQAQNLTLLRNMQSLRGFRAFSYLPWLVGTSRKGFVGRITRVE
KASERGWGTGAAVTAAIAGGTDIVRVHDVKEMCQVARMADAIYRQGLNA
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacaccataccttgctttgtggttgataccaccgtgcttctttgcagtacacgt
ctttctccttctttttctcctagcattggtcggcaatgcgtcaaatccaacacctatgac
aggttcccgttagctcataagaatatctcgaccttatcctccaagctccagtttgcagat
gtcggctatagctgcacgctaacccgagatttcgacagtcatgcataccggtctcatggg
cgaaatccccttcgtcgagactatagcacacctgcctttttgcagaggcataagacaatc
atagccctggcttctagatctgtgcaaactcactattgctcttcttatatgtctcccgac
ggcgcgggaaacactgctaacatggctgtgtcctcgcaacatcgcgctttcatcgcccta
ggtagcaacatgggcgaccgggttgccatgatagagcaggcatgcatggaaatggaggca
agaggtataaggatcatgaggacgagttctctcttcgagaccgcacccatgtacgtgacg
aatcaggatccttttatcaatggggtttgtgaagttgaaacgaacatgcatccaatcgag
ctgcttgatacgctgcaatcgatagaaattgcgatgggaaggaggaagatcgtggataag
ggtcctcgagtcatagacctggatatactattgtacggcgaggaggtattctcgaatgaa
cggctaaatattccccataagctcatgctcgaacgtgaattcgtgctacggccactttgc
caattgatacccgaaagtataccaccctcaagcaaagattcgaattgctatcaaacctac
ttagatgcacttccatcttcggaccctgcaccacaagcaataacgccaatgcacacgaac
atgcctccgctaaacccctcaaaccccaaacgccacactcacatcatggccgtactcaac
gtcaccccagactccttctcagacggcggcctgcactccgcagcagacgcctccacgctc
acccaaaccacccggtacttcatcaacaacggcgctaccataattgacatcggcggcgaa
agcacccgtcccagctccgaccccaccaccgaacaggatgaactctcccggaccatcccc
gccatcaaactcatccgctccctccccgaagctgatcacatcgccatcagcatcgacacc
taccgcgctagtgttgcccaagccgctgtcgccgccggagcagatatcatcaacgatgtc
tccgccggcctcatggatcccgagatgttgcccacgatggcccgtttgggcaaaaccgtc
atcctttcacacatgcgcggcaccccaaagaccatgaccaaactcaccgactacccatca
ggagtcatcgacggcgttagcaccgaactcgcccaacgcatcgcggccgcagaggctgcg
ggagtcaggcgctggcgcatcatcgccgatccgggtgtgggttttgcgaagaaccaagcg
cagaatctcactttgctccgaaacatgcagtccttgcgtgggttcagagcgttcagttac
ttgccgtggttggtaggcacaagtcggaaaggatttgttggccgaatcacgcgcgttgag
aaggcgagtgagcgggggtggggcacgggagccgcggttacagcggcgattgctggtggc
acggacatcgtgcgggttcacgatgtcaaggagatgtgtcaagttgcgcggatggcggat
gcgatttatcggcaaggattgaatgcgtga

DBGET integrated database retrieval system