KEGG   Coccidioides posadasii: CPC735_043030Help
Entry
CPC735_043030     CDS       T01332                                 

Definition
Mov34/MPN/PAD-1 family protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
cpw  Coccidioides posadasii
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CPC735_043030
Enzymes [BR:cpw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CPC735_043030
Peptidases [BR:cpw01002]
 Metallo Peptidases
  Family M67
   CPC735_043030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 544 aa AA seqDB search
MIPPLNVAEIARQAAAYEYSPSTKLQYWLRTAASLVKEADVYEREGNDQQAYLLLFRHAQ
LVLVNLIMHPQAQDPSCRRGLAEAQREVQNSLKRLEVLKPRINQRYKQYQEARDIEFRKT
IAAQLDDHADLLRDRESHDPAIAGRPQPLAAAENKDLAVKLAQKELKRRAAAKLGHYLSE
NLHPHKQRRLLAPVQGQPTQEHHGVSDQDDLASRLQEVRARVEGDQTHRTSIQESQPASS
EVQTILRRPEPNRSATGYKYPAVPAQSIFTITETVPPLPSKGLLQPLPLRPPAIPAKIPE
PPSRPISATPPSAPPVPSKVAPNTTSITPPEPPRQPDYITPSSSDLQPSTFTFKPSSYLE
NGNPLRTIFISPDLRQRFLEIAYPNTRRNLETCGILCGSLISNAFFISKLLIPEQESTPD
TCEMVNEGAVFEYCDAEDLMVLGWIHTHPTQTCFMSSRDLHTQSGYQVMLAESIAIVCAP
SRTPDWGVFRLTDPPGLKTVLACTKQGLFHPHEETDIYTDALRPGHVFEAKGLEFETVDL
RNKR
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgattccgccgctcaacgtcgcggaaatcgctcgccaggccgcagcgtacgagtacagc
cccagcacgaagctgcaatactggctgaggaccgctgcgtctttggtgaaagaggcagat
gtctacgagcgcgaaggaaacgaccagcaggcatacctcctccttttcagacatgcacag
ctcgtccttgtcaatcttattatgcacccccaggcccaggacccgagttgccggcgtggc
ctggccgaagcgcagcgggaggtgcagaactcgctgaaaagattggaagtcctgaagccc
cggataaatcagcgatacaagcagtatcaagaggcaagagatattgagtttaggaagact
atagccgctcagctggacgaccatgcagacctccttcgtgatcgcgagtctcatgaccct
gcgatagctggacgaccacagcccctcgctgctgcagagaacaaggacctagccgtgaaa
ctggcccaaaaggagctgaaacgcagagcagcggctaaattggggcactacctgagcgag
aatcttcacccgcacaagcaacggagactgctcgcgcctgttcaaggtcaaccaacgcag
gagcatcacggcgtgtccgaccaggacgatcttgctagccgactacaggaagtgcgagcc
agagttgaaggggaccagactcacaggacaagcatccaggaatctcaacctgcgagttct
gaggttcaaacaatactacggcggcctgagccgaaccgttcagcgacaggctacaagtat
cccgctgttcctgcacagagcatcttcacaatcacggaaacagtgccgccacttccaagt
aaagggctgcttcagcctctgccattgcggccgccagcaattccagctaaaatccccgaa
cctccctccagaccaatatccgctacacctccttccgccccgccagttcctagtaaagtc
gcgcctaacaccacaagtatcacccctcccgagccacctcgccaacccgactacatcacc
ccgtcttcatccgaccttcaaccgtccacattcaccttcaaaccatcctcctacctcgag
aatggcaacccgctccgcacaatcttcatttcccctgacctccgccaacgcttcctcgaa
atcgcctaccccaacacccgtcgcaaccttgaaacatgcggcatcctctgcggctccctg
atctccaacgcctttttcatctccaagctccttatccccgaacaagaatccacaccagac
acctgcgaaatggtcaacgaaggcgccgtcttcgagtactgtgacgccgaggacctcatg
gtcctgggctggatacacacgcacccaacgcagacctgtttcatgagctcgcgtgatctg
cacactcagtccggataccaggtcatgctcgctgagagtatcgctatcgtctgtgcgccc
agcaggacgccggactggggtgtgtttagattgaccgatccaccgggattgaagaccgtc
ctggcgtgtacgaagcaggggctcttccacccacatgaagagactgatatctatacggat
gcattgaggccgggacatgtgtttgaggcaaagggtttggagttcgagacagtggatttg
aggaataaaaggtga

DBGET integrated database retrieval system