KEGG   Coccidioides posadasii: CPC735_043470Help
Entry
CPC735_043470     CDS       T01332                                 

Definition
kinase domain containing protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
cpw  Coccidioides posadasii
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    CPC735_043470
Enzymes [BR:cpw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CPC735_043470
Protein kinases [BR:cpw01001]
 Serine/threonine protein kinases: Other group
  TTK family
   CPC735_043470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 861 aa AA seqDB search
MTLTASPTPLPSGQRSASNRQRPASLHDLHRRTVSRHIGSNGSPHGISVEIGNMAEDLAR
SRAISAGDSSDDDDFPEPIKFSASVKALLGEDASGLDTSPRRGTRDGSENQPYQREDGRR
QHVKQVRIASPDQRASASPPLRIVRLGLESRRSPSSLGGEASILSGRGEREYNVHEGNRD
DFITPAPRTRSVRIATGSRSTTRSPSASLPSANGGSSSDASRVEERSFLDDGMKSGQDDR
SYARAGMGTVPRTRAEVETGVQGSLRVKRVGKLSGSFLNGPARRGVLRRQSEEEPRAEHQ
EESFLDSGSRNRYEESQEPSPLEDSMLRNKRSFESRRESPRFSDNNVGASLSRTPQSIPI
RQRSLRNSGSGSVSALESGSPLSHHLNSSSGSRQRRSPNVDMNPVYRVPSPPELPAKHDQ
ENGPPPTFKRTKPEGFGLLNKIEKFSVLHEEDKGAIKAAPETVSPRKPLGKVSNNTPRRP
APPPPPKMSVLETATAVAGAASSSQSKRKRAQVSINRKVYTRLDCIGRGGSSRVYRVMAE
NCKIFALKRVHLEDVDPHALAGYKGEIDLLKKLRNVGRVVQLFDWEINEEKHALSVLMEM
GESDLHRILTHKLNTEDAVFDPVFARFYWKEMLECVQAVHDFDIVHSDLKPANFLLVHGR
LKLIDFGIANTIQDHTVNVHREQQIGTPNYMAPEALIDCNAALGLPATAGKMMKLGKPSD
VWSLGCILYQMVYGKAPFAHIAKPLERIMAIPNPRVPINYPPVGVGNVSVQSNVLRTLKG
CLQRDQALRPTIKQLLSPNDPFLYPETHMEGTVPITEETLGRILTNVVNHCRARGPPTAQ
ELAGWPAGFFAKIKAAMEEDR
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgacccttactgcctcccctacgccattgccttcgggccagaggagtgcgagtaatcgc
cagcggccagcatcactacatgatctccaccgcagaacggtatcaagacatatcggcagc
aacggatcgccacatggaatttcggtggagattgggaacatggctgaagatttagcgcga
tcgagggcgatttcggcgggagatagctcagacgatgatgattttccagagcccatcaag
ttcagcgcgtcggtgaaggcgttgctaggggaggatgcgtcgggattggacacgtcgccg
agaagaggtaccagagacggatcggaaaatcaaccttatcagagggaggacggtcgaaga
cagcatgtgaagcaggtcagaattgcgtcgccagatcagcgtgccagtgcgagtcccccg
ctgaggattgttcgtcttggattggagtcgcgccgctcaccaagttcgcttgggggagaa
gcctcgattttgtcaggaagaggagagagggagtataatgtccacgaggggaatcgcgat
gattttatcaccccggcaccgcggacaagaagtgttaggattgcgacaggttcgaggagc
acgactcgctctccgtcagcatcactaccgtcagccaatggaggctcatctagcgatgct
agtagggttgaggagcggtcctttttggacgatggcatgaagagcggccaagacgaccgt
agttatgctcgagctgggatgggaacggtaccccgaacaagggcggaagtcgagactgga
gttcagggttctctacgagtgaagcgtgtgggcaaattgtcaggttcctttcttaatggt
cctgcaaggagaggcgtcctccggcgccagagtgaggaagagccgcgcgccgagcatcag
gaagaatcattccttgattctggatcacgcaacagatatgaagaatctcaggaaccgtcg
ccgttggaagattctatgctacggaataagcggtcctttgagagccggcgcgaatctcca
cgattttcagacaacaatgttggcgcgtcattatctcgaactcctcaatccataccaatc
cggcaacgatcgctccgaaacagtgggagtgggagtgtgagcgcgctggaaagtggctcc
cctctttcccatcatctcaattcctcgtctggatcccggcagcgtcggtcaccaaacgtc
gatatgaatccagtatatcgtgtgccttcgccgccggagctaccggcaaaacatgatcag
gagaatggtccaccgcctacatttaagaggactaaacctgaagggtttggactgctaaac
aaaatcgagaagttctctgttctacatgaagaggacaaaggcgccatcaaggccgcgcca
gagacagtatccccacggaagccactagggaaagtcagcaacaatacccctcgccgacct
gctccgcctcctccacctaaaatgagtgtgctggaaaccgctaccgccgttgccggggcc
gccagctcctcgcaatctaagagaaagcgagcgcaagtatctatcaaccgaaaggtctat
acacgactagactgcataggccgtggtggtagttcacgagtctaccgcgtgatggctgaa
aactgtaagatatttgcgcttaagcgggtgcacctagaggatgtcgatccccatgcattg
gctggctacaaaggagaaatcgatcttttgaagaagctgcggaatgtcgggcgcgtcgtt
caactgttcgattgggagatcaacgaggagaaacatgcactaagcgttcttatggagatg
ggagaatcggatctccatcggatccttacgcacaaattgaacaccgaggatgctgttttc
gatccggtctttgctcgattctactggaaagagatgctggaatgcgtgcaagctgtacat
gactttgacattgtccattccgatctcaaacctgcgaatttcctcctggttcatggcagg
ctcaagcttatcgattttgggattgcaaacactatccaagaccacacagtcaatgtgcac
cgtgaacagcaaataggaactccgaactacatggctcctgaagctcttatcgattgcaac
gctgcccttggtcttcctgccaccgctggaaagatgatgaaattgggcaaaccgagtgac
gtgtggagcttggggtgcatactctatcagatggtctacggcaaagcgccttttgcccat
atcgccaagccccttgaacggatcatggctattcccaatcctagagtaccgatcaattat
cctccagtcggcgtgggtaacgtatccgtgcaatcaaacgttctgcgaacattgaagggg
tgtctgcaacgcgatcaggcacttaggccaacgataaagcaattactcagccctaacgat
ccgttcttgtatccggagacacacatggagggtacggttcctataaccgaggagacgctg
ggcaggatattgactaacgttgtcaatcattgccgtgctcgaggacctcccacagcccaa
gaattggcggggtggccggctgggttctttgcaaagattaaagctgccatggaagaggat
agatga

DBGET integrated database retrieval system