KEGG   Coccidioides posadasii: CPC735_043510Help
Entry
CPC735_043510     CDS       T01332                                 

Definition
Common central domain of tyrosinase family protein (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
cpw  Coccidioides posadasii
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    CPC735_043510
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CPC735_043510
Enzymes [BR:cpw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     CPC735_043510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 663 aa AA seqDB search
MAAKGAWVWAVLQVIACIAFQAHAYDIRGVRGGVQASGERPARQNLETFQESGPAFDLYI
LALLKFQDEDQNRMLSYYDVSSIHGYPFEAWDGVEGIGGGGYCAHASTIFPTWHRPYLAL
FEEMIWNHAQVIARGYRDSLRSTYVEAARTLRIPYWDWASNPELPRCVVTPQIRITTPNG
EATIKNPLYSYTINPTAGKGFPPRDPLSQYPDTVRAPDDEGQSQMEEVQRRLRANGAYFR
QATYSLLSSEPNYTIFSTSAVRDRGNNYNNLETIHGQVHVAVGGPGGHMTYVPWSSFDPV
FWLHHANVDRLLAMWQAIYPESWVQPLASMSRTYVSSAGTVEDGNTPLAPFHSRGSAFWT
SDSARSTKAFGYTYPEIQDWGVSAAQLQSSVRQHANRLYNRRRRRRSEHGLKLPGFGKGK
LFDFASVLEKAFKFTEVLTDLAEMSLADFDKLGINNLHKQWVANIKVDMNAISNPFRIHF
FLGEPPSDPNTWDHAANLVGTYSLFSNSMPNPTDTAHYVYGQMPLSHAIAEAHSHSLIKD
IGAAGVVPLLKTHLQWRVQELSGRVIDVSKFSDSSVGGEPGLEVYIVERDVDPIRETTEF
PRFSDWKIYKEVTEGKPGGVKSGGRSRGGSGHGIRKHFAGGHGRHGGQKHASCKAGNKNS
HSY
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaaaggagcgtgggtttgggccgtattgcaggtcatagcctgcatcgcgttc
caagcccatgcctacgatattcgaggcgttaggggaggcgtccaagcatccggggaaagg
cctgcgcgccagaacctggaaacattccaggagtctgggccagcattcgatctatacata
ctggcccttctaaagttccaggatgaggatcagaacaggatgttgagttattatgatgtc
tcatctattcacggatacccgtttgaagcgtgggatggcgtggaaggtattggcggaggg
ggctactgtgcacatgcttcaacaatatttcctacatggcaccgcccataccttgctctt
ttcgaggagatgatctggaaccacgcccaggtaattgcgcgaggatatcgggactccctc
cgcagcacatatgttgaagcggccaggaccttgcgaattccttactgggactgggccagt
aatccggagcttccacgatgtgtagtcacccctcagatccggatcaccacacccaacgga
gaagccaccatcaaaaacccgctgtattcctatactatcaatcccaccgctggaaaagga
ttccctccgcgagatccactgtcccagtatccagataccgtccgggcgccagacgacgaa
ggtcaaagtcaaatggaagaggttcagcgaagactgagagcgaacggtgcatacttccgc
caggccacatattctctgcttagtagcgaacctaactacactattttttcgaccagcgcc
gttcgagatcgtgggaacaactataataacttagaaaccatccacggccaagtccatgtt
gctgtcggtggtcccggggggcatatgacatacgtcccttggtcctcgttcgatcccgtt
ttttggctgcatcacgctaacgtggatcgcctccttgctatgtggcaagcgatctaccct
gagtcctgggtgcaaccattggcttccatgagtcggacctatgtctcgagtgcaggaact
gttgaagatggtaatacccctctcgctccattccactcgaggggcagcgcgttctggacc
tctgattcggctcggtcgacaaaggcgttcggctacacttatcctgagattcaagactgg
ggtgtcagcgcagcgcaactccagagcagcgttcgccaacatgccaacaggctatacaac
aggagaaggcgaagaagatcggaacacggcctcaagctgccaggctttggaaagggcaaa
ttgttcgactttgctagcgtcttggagaaggcattcaagttcacggaggtcttgacggat
cttgccgaaatgagtcttgctgactttgacaagctcggcatcaataacttgcacaagcaa
tgggttgcgaatatcaaagtggacatgaacgctatctcgaacccattccgcatccacttc
ttccttggagagccaccaagtgaccccaatacctgggatcacgcagccaaccttgtcggc
acctactcgctcttctccaactccatgcccaaccctaccgacacagctcactatgtctac
ggccaaatgccactaagccacgcgatcgctgaagcccattcccactccctcatcaaagac
atcggcgcggcaggcgtcgttcctctcctcaagactcaccttcaatggcgggtccaggag
ctttccggcagagtcatcgatgtatctaaattttctgattcgtctgtcggcggcgagccc
ggtttggaagtatacatcgtcgagagagacgttgaccccattagagagaccaccgagttt
cccaggtttagcgactggaagatttacaaggaggtcaccgagggcaagcctggtggtgtt
aagagcggtggcagaagtcgcggtggcagcggtcacggaatccgtaagcacttcgctggt
ggacatggacgacatggcggccagaaacatgcatcatgcaaggccggaaataagaatagc
cactcgtattag

DBGET integrated database retrieval system