KEGG   Coccidioides posadasii: CPC735_043510Help
Entry
CPC735_043510     CDS       T01332                                 

Definition
Common central domain of tyrosinase family protein (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
cpw  Coccidioides posadasii
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:cpw00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:cpw00740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 663 aa AA seqDB search
MAAKGAWVWAVLQVIACIAFQAHAYDIRGVRGGVQASGERPARQNLETFQESGPAFDLYI
LALLKFQDEDQNRMLSYYDVSSIHGYPFEAWDGVEGIGGGGYCAHASTIFPTWHRPYLAL
FEEMIWNHAQVIARGYRDSLRSTYVEAARTLRIPYWDWASNPELPRCVVTPQIRITTPNG
EATIKNPLYSYTINPTAGKGFPPRDPLSQYPDTVRAPDDEGQSQMEEVQRRLRANGAYFR
QATYSLLSSEPNYTIFSTSAVRDRGNNYNNLETIHGQVHVAVGGPGGHMTYVPWSSFDPV
FWLHHANVDRLLAMWQAIYPESWVQPLASMSRTYVSSAGTVEDGNTPLAPFHSRGSAFWT
SDSARSTKAFGYTYPEIQDWGVSAAQLQSSVRQHANRLYNRRRRRRSEHGLKLPGFGKGK
LFDFASVLEKAFKFTEVLTDLAEMSLADFDKLGINNLHKQWVANIKVDMNAISNPFRIHF
FLGEPPSDPNTWDHAANLVGTYSLFSNSMPNPTDTAHYVYGQMPLSHAIAEAHSHSLIKD
IGAAGVVPLLKTHLQWRVQELSGRVIDVSKFSDSSVGGEPGLEVYIVERDVDPIRETTEF
PRFSDWKIYKEVTEGKPGGVKSGGRSRGGSGHGIRKHFAGGHGRHGGQKHASCKAGNKNS
HSY
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaaaggagcgtgggtttgggccgtattgcaggtcatagcctgcatcgcgttc
caagcccatgcctacgatattcgaggcgttaggggaggcgtccaagcatccggggaaagg
cctgcgcgccagaacctggaaacattccaggagtctgggccagcattcgatctatacata
ctggcccttctaaagttccaggatgaggatcagaacaggatgttgagttattatgatgtc
tcatctattcacggatacccgtttgaagcgtgggatggcgtggaaggtattggcggaggg
ggctactgtgcacatgcttcaacaatatttcctacatggcaccgcccataccttgctctt
ttcgaggagatgatctggaaccacgcccaggtaattgcgcgaggatatcgggactccctc
cgcagcacatatgttgaagcggccaggaccttgcgaattccttactgggactgggccagt
aatccggagcttccacgatgtgtagtcacccctcagatccggatcaccacacccaacgga
gaagccaccatcaaaaacccgctgtattcctatactatcaatcccaccgctggaaaagga
ttccctccgcgagatccactgtcccagtatccagataccgtccgggcgccagacgacgaa
ggtcaaagtcaaatggaagaggttcagcgaagactgagagcgaacggtgcatacttccgc
caggccacatattctctgcttagtagcgaacctaactacactattttttcgaccagcgcc
gttcgagatcgtgggaacaactataataacttagaaaccatccacggccaagtccatgtt
gctgtcggtggtcccggggggcatatgacatacgtcccttggtcctcgttcgatcccgtt
ttttggctgcatcacgctaacgtggatcgcctccttgctatgtggcaagcgatctaccct
gagtcctgggtgcaaccattggcttccatgagtcggacctatgtctcgagtgcaggaact
gttgaagatggtaatacccctctcgctccattccactcgaggggcagcgcgttctggacc
tctgattcggctcggtcgacaaaggcgttcggctacacttatcctgagattcaagactgg
ggtgtcagcgcagcgcaactccagagcagcgttcgccaacatgccaacaggctatacaac
aggagaaggcgaagaagatcggaacacggcctcaagctgccaggctttggaaagggcaaa
ttgttcgactttgctagcgtcttggagaaggcattcaagttcacggaggtcttgacggat
cttgccgaaatgagtcttgctgactttgacaagctcggcatcaataacttgcacaagcaa
tgggttgcgaatatcaaagtggacatgaacgctatctcgaacccattccgcatccacttc
ttccttggagagccaccaagtgaccccaatacctgggatcacgcagccaaccttgtcggc
acctactcgctcttctccaactccatgcccaaccctaccgacacagctcactatgtctac
ggccaaatgccactaagccacgcgatcgctgaagcccattcccactccctcatcaaagac
atcggcgcggcaggcgtcgttcctctcctcaagactcaccttcaatggcgggtccaggag
ctttccggcagagtcatcgatgtatctaaattttctgattcgtctgtcggcggcgagccc
ggtttggaagtatacatcgtcgagagagacgttgaccccattagagagaccaccgagttt
cccaggtttagcgactggaagatttacaaggaggtcaccgagggcaagcctggtggtgtt
aagagcggtggcagaagtcgcggtggcagcggtcacggaatccgtaagcacttcgctggt
ggacatggacgacatggcggccagaaacatgcatcatgcaaggccggaaataagaatagc
cactcgtattag

DBGET integrated database retrieval system