KEGG   Coccidioides posadasii: CPC735_043740Help
Entry
CPC735_043740     CDS       T01332                                 

Definition
acetyltransferase, GNAT family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cpw  Coccidioides posadasii
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CPC735_043740
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    CPC735_043740
Enzymes [BR:cpw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CPC735_043740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 850 aa AA seqDB search
MDNDELRRQLGQLFIVGFRSLIATDEVKSLIQAPYYCGTIILFQRNIESAEQLIALTNDL
QQTARDAGHTRPLFIAVDQENGLVTRIKPPIATQLPGAMALGATGYIDDAVRVSSATGEI
LDALGINMNYAPLCDVNSEPANPVIGVRSPGDDGTFVGRITSNIAKGLRKNNIVPCAKHF
PGHGSTKVDSHYGVPVVRKPKEDLEACELLPFRRAVAEGIEAIMTSHVVMSAFDDAGLPS
SVSKDVVNFLRRDLQHEGLIITDCLEMDAIRVQIGTEKGAVRALAAGVDCPMICHTYDVQ
VRALEEAFNACKIGTIPLRQISQSVSRVHALKDKFFDWGSVFRHRSVNTVTQLNLKHQEL
ANDIYARSVTVIRDDQKALPLSRGGSLVYVYPCGKALRVGASGSGETVTCVPYTPPEFSQ
ILKLFVPDLIECPFFDDATLDESTKSKISQADAVILASRNCRLNPSQRLIGTQLVNHSKK
LVSIATCVPYDFLNSGIKTCLAMYEPTVEAFQAAANVIFGVNEGVGKLPVCTKRPPLPID
SFDPERDMKLAINLWHMLLPHYAVPADRLHHLLDRPNGKHFTIYVEDQLAGFIATYVNED
RPTAYISVLLVHPKFRSRGVGTALVEHARRQLRGAARSVTIGSSFPRFFLGVPLDIPEEA
QNFFIHRGFVPTRGPSSRDYTADLRTYQPPEGVLQRAAAAGVTFTPWRINLYLECMANIR
ELWGDDEVWLGAYERLARQNRHEQVMVAMDRSGKQIGWTLMQELGLGMTNDLAFMPLLGQ
KTGQIGCLGIHPDARNKGVGLALVVSAAMDMKRRGLEKVFVDWTNHVNFYEKAGFEVWRE
YRSMTLKESV
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atggacaatgacgagttacgcaggcagcttggccagctgttcatcgtcggcttccggtcg
ctgatcgccacagacgaggtcaaatcgctcatccaggccccatactactgcggcactatc
attctcttccagcggaacattgagagtgcggaacaactgattgccctcacaaatgacctt
cagcagacggcaagggatgctggccacacccgcccacttttcattgctgtcgaccaggaa
aacggccttgtcacccggattaagcctcccattgccacccagctgcccggtgctatggca
cttggcgccaccggttacatagacgatgccgtccgcgtctccagtgccacaggtgaaata
ctggatgctctaggcatcaacatgaattatgctccgctgtgcgacgtcaactcagagccg
gccaaccccgtcatcggtgtccgatctccgggcgatgacgggaccttcgtcggcagaatc
acgagcaatatcgccaaaggactgaggaagaacaacatcgtaccctgtgcaaagcacttc
ccaggacacggaagcacaaaagttgattcccactacggtgttcctgtcgttaggaaaccc
aaagaggatcttgaagcgtgtgaactccttccgtttcgcagagcagtcgctgaggggatc
gaggccataatgacctcccacgttgttatgtcagccttcgatgacgctggattgccatcc
tccgtcagcaaagatgttgtaaatttcctgcgtcgagacctacagcatgaaggtctcatc
atcactgactgtcttgaaatggatgctatacgcgtgcagatcgggaccgaaaagggggcc
gtccgggccttagctgccggtgtcgattgcccgatgatatgtcacacttatgatgtccaa
gttcgagcacttgaagaggcattcaatgcttgcaagattggcactattccacttcgtcag
atctcccagtccgtttcacgggttcacgccttgaaagataagttctttgattggggctca
gtttttcgccaccgctcagttaacaccgttacccaactaaacttgaagcaccaggaactg
gcaaacgatatctacgcccggagcgtcactgttatcagggatgaccagaaagcgctccct
ctgtccaggggagggtccttggtctacgtttatccttgtgggaaagctctccgtgtgggt
gcttctggaagcggcgaaacggtcacctgtgttccttacacaccaccggaattctcacaa
attttgaaactctttgtcccggatctgatcgaatgtccctttttcgatgacgcaactcta
gatgaaagcacaaaatccaagatctcacaggccgacgccgtgattttggcctcgcggaac
tgcaggttgaatccaagccaaagactgataggcactcagcttgtgaatcattcaaaaaaa
ttagtcagcattgctacatgtgttccatatgatttcctaaactcagggattaaaacttgt
cttgccatgtacgaaccgaccgttgaggccttccaagcggcggccaatgtcatcttcggg
gttaatgagggggtaggaaagcttcctgtttgtacaaaacgcccgccacttcccatagat
tcttttgatccggaacgtgacatgaaactggcgataaacctatggcatatgttactcccc
cactatgctgtccctgcagaccgtttgcatcatcttctcgatcgcccaaacgggaaacat
tttacaatttacgtggaagaccaacttgcaggttttatagctacctatgttaatgaagat
agacccacggcatacatttccgttctccttgttcacccgaagtttcggtcgcgcggggtc
ggaacagccttggttgagcatgctcggcgtcagttgcgtggagcggctcgttccgtcaca
ataggttcgagcttccctcgatttttccttggcgtccccttagatataccagaagaggcc
cagaatttttttatccatcgtggtttcgttccgaccagaggcccctcgtcgagagactac
acggcggacctaaggacctatcaacccccagaaggagttcttcagcgtgccgccgcggca
ggcgtaacattcactccttggagaataaatctgtatcttgaatgtatggctaacatacgt
gagctctggggtgatgatgaagtctggcttggtgcatatgagcgtctggcacggcagaac
cgacacgagcaagtcatggtggcgatggatcgttccggaaaacaaatagggtggactctg
atgcaagaactaggtctaggtatgaccaacgatcttgcctttatgccgttactaggccag
aaaaccggccagattggctgtctgggtattcatcccgatgcgaggaataaaggtgtgggt
ctagcgttggttgtgagcgctgcaatggatatgaagaggagaggcttagagaaggtattt
gttgattggacgaatcatgtcaatttttatgaaaaagcgggatttgaggtgtggagggag
tatcgatcaatgactctgaaagagtccgtgtag

DBGET integrated database retrieval system