KEGG   Coccidioides posadasii: CPC735_043740Help
Entry
CPC735_043740     CDS       T01332                                 

Definition
(RefSeq) acetyltransferase, GNAT family protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00520  Amino sugar and nucleotide sugar metabolism
cpw00531  Glycosaminoglycan degradation
cpw01100  Metabolic pathways
cpw01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CPC735_043740
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    CPC735_043740
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    CPC735_043740
Enzymes [BR:cpw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CPC735_043740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3 Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 FR47 Acetyltransf_9 Acetyltransf_CG Acetyltransf_6 DUF3749 Glyco_hydro_3_C Acetyltransf_13
Motif
Other DBs
NCBI-GeneID: 9693558
NCBI-ProteinID: XP_003068075
UniProt: C5PBE6
Position
Unknown
AA seq 850 aa AA seqDB search
MDNDELRRQLGQLFIVGFRSLIATDEVKSLIQAPYYCGTIILFQRNIESAEQLIALTNDL
QQTARDAGHTRPLFIAVDQENGLVTRIKPPIATQLPGAMALGATGYIDDAVRVSSATGEI
LDALGINMNYAPLCDVNSEPANPVIGVRSPGDDGTFVGRITSNIAKGLRKNNIVPCAKHF
PGHGSTKVDSHYGVPVVRKPKEDLEACELLPFRRAVAEGIEAIMTSHVVMSAFDDAGLPS
SVSKDVVNFLRRDLQHEGLIITDCLEMDAIRVQIGTEKGAVRALAAGVDCPMICHTYDVQ
VRALEEAFNACKIGTIPLRQISQSVSRVHALKDKFFDWGSVFRHRSVNTVTQLNLKHQEL
ANDIYARSVTVIRDDQKALPLSRGGSLVYVYPCGKALRVGASGSGETVTCVPYTPPEFSQ
ILKLFVPDLIECPFFDDATLDESTKSKISQADAVILASRNCRLNPSQRLIGTQLVNHSKK
LVSIATCVPYDFLNSGIKTCLAMYEPTVEAFQAAANVIFGVNEGVGKLPVCTKRPPLPID
SFDPERDMKLAINLWHMLLPHYAVPADRLHHLLDRPNGKHFTIYVEDQLAGFIATYVNED
RPTAYISVLLVHPKFRSRGVGTALVEHARRQLRGAARSVTIGSSFPRFFLGVPLDIPEEA
QNFFIHRGFVPTRGPSSRDYTADLRTYQPPEGVLQRAAAAGVTFTPWRINLYLECMANIR
ELWGDDEVWLGAYERLARQNRHEQVMVAMDRSGKQIGWTLMQELGLGMTNDLAFMPLLGQ
KTGQIGCLGIHPDARNKGVGLALVVSAAMDMKRRGLEKVFVDWTNHVNFYEKAGFEVWRE
YRSMTLKESV
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atggacaatgacgagttacgcaggcagcttggccagctgttcatcgtcggcttccggtcg
ctgatcgccacagacgaggtcaaatcgctcatccaggccccatactactgcggcactatc
attctcttccagcggaacattgagagtgcggaacaactgattgccctcacaaatgacctt
cagcagacggcaagggatgctggccacacccgcccacttttcattgctgtcgaccaggaa
aacggccttgtcacccggattaagcctcccattgccacccagctgcccggtgctatggca
cttggcgccaccggttacatagacgatgccgtccgcgtctccagtgccacaggtgaaata
ctggatgctctaggcatcaacatgaattatgctccgctgtgcgacgtcaactcagagccg
gccaaccccgtcatcggtgtccgatctccgggcgatgacgggaccttcgtcggcagaatc
acgagcaatatcgccaaaggactgaggaagaacaacatcgtaccctgtgcaaagcacttc
ccaggacacggaagcacaaaagttgattcccactacggtgttcctgtcgttaggaaaccc
aaagaggatcttgaagcgtgtgaactccttccgtttcgcagagcagtcgctgaggggatc
gaggccataatgacctcccacgttgttatgtcagccttcgatgacgctggattgccatcc
tccgtcagcaaagatgttgtaaatttcctgcgtcgagacctacagcatgaaggtctcatc
atcactgactgtcttgaaatggatgctatacgcgtgcagatcgggaccgaaaagggggcc
gtccgggccttagctgccggtgtcgattgcccgatgatatgtcacacttatgatgtccaa
gttcgagcacttgaagaggcattcaatgcttgcaagattggcactattccacttcgtcag
atctcccagtccgtttcacgggttcacgccttgaaagataagttctttgattggggctca
gtttttcgccaccgctcagttaacaccgttacccaactaaacttgaagcaccaggaactg
gcaaacgatatctacgcccggagcgtcactgttatcagggatgaccagaaagcgctccct
ctgtccaggggagggtccttggtctacgtttatccttgtgggaaagctctccgtgtgggt
gcttctggaagcggcgaaacggtcacctgtgttccttacacaccaccggaattctcacaa
attttgaaactctttgtcccggatctgatcgaatgtccctttttcgatgacgcaactcta
gatgaaagcacaaaatccaagatctcacaggccgacgccgtgattttggcctcgcggaac
tgcaggttgaatccaagccaaagactgataggcactcagcttgtgaatcattcaaaaaaa
ttagtcagcattgctacatgtgttccatatgatttcctaaactcagggattaaaacttgt
cttgccatgtacgaaccgaccgttgaggccttccaagcggcggccaatgtcatcttcggg
gttaatgagggggtaggaaagcttcctgtttgtacaaaacgcccgccacttcccatagat
tcttttgatccggaacgtgacatgaaactggcgataaacctatggcatatgttactcccc
cactatgctgtccctgcagaccgtttgcatcatcttctcgatcgcccaaacgggaaacat
tttacaatttacgtggaagaccaacttgcaggttttatagctacctatgttaatgaagat
agacccacggcatacatttccgttctccttgttcacccgaagtttcggtcgcgcggggtc
ggaacagccttggttgagcatgctcggcgtcagttgcgtggagcggctcgttccgtcaca
ataggttcgagcttccctcgatttttccttggcgtccccttagatataccagaagaggcc
cagaatttttttatccatcgtggtttcgttccgaccagaggcccctcgtcgagagactac
acggcggacctaaggacctatcaacccccagaaggagttcttcagcgtgccgccgcggca
ggcgtaacattcactccttggagaataaatctgtatcttgaatgtatggctaacatacgt
gagctctggggtgatgatgaagtctggcttggtgcatatgagcgtctggcacggcagaac
cgacacgagcaagtcatggtggcgatggatcgttccggaaaacaaatagggtggactctg
atgcaagaactaggtctaggtatgaccaacgatcttgcctttatgccgttactaggccag
aaaaccggccagattggctgtctgggtattcatcccgatgcgaggaataaaggtgtgggt
ctagcgttggttgtgagcgctgcaatggatatgaagaggagaggcttagagaaggtattt
gttgattggacgaatcatgtcaatttttatgaaaaagcgggatttgaggtgtggagggag
tatcgatcaatgactctgaaagagtccgtgtag

DBGET integrated database retrieval system