KEGG   Coccidioides posadasii: CPC735_045450Help
Entry
CPC735_045450     CDS       T01332                                 

Definition
(RefSeq) isocitrate lyase, putative
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00630  Glyoxylate and dicarboxylate metabolism
cpw01100  Metabolic pathways
cpw01110  Biosynthesis of secondary metabolites
cpw01200  Carbon metabolism
Module
cpw_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CPC735_045450
Enzymes [BR:cpw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CPC735_045450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 9690790
NCBI-ProteinID: XP_003065320
UniProt: C5PEV7
Position
Unknown
AA seq 538 aa AA seqDB search
MSLSVEQEEQKYWEEVEAVKQWWKDSRWRYTKRPFTAEQIVAKRGNLKIEYPSNVQSKKL
WKLVEEKFKTKTASFTYGCLDPTMVTQMVKYLDTVYVSGWQSSSTASSTDEPSPDLADYP
MNTVPNKVNQLWMAQLFHDRKQREERLRNPKEKRASLANIDYLAPIIADADTGHGGLTAV
MKLTKLFIERGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLVAIRAQADIMGTDLL
AIARTDSEAATLITSTIDPRDHAFVVGSTNPTLEPLNDLMIAAERAGKNGAELQAIEDSW
IAKAGLKRFEDAVIDQIKASSAANKQATIGAFLREIKGKSNKEARAIARQILGTDIFWDW
DAPRTREGYYRYQGGCQCAINRAVAFAPFADLIWMESKLPDYAQAKEFAEGVHAVWPQQK
LAYNLSPSFNWKAAMPRDEQETYIRRLGELGYCWQFITLAGLHTTALISDQFAKAYAKQG
MRAYGELVQEPEMENKVDVVTHQKWSGANYVDELLKMVTGGISSTSAMGKGVTEDQFK
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttgtcagtcgagcaggaggagcaaaagtactgggaggaggttgaggccgtcaaa
cagtggtggaaggattcgagatggcggtataccaagcggccattcacagctgagcagatt
gtcgctaagcgaggaaacctgaagattgaatatccttcaaacgtgcagagcaaaaagcta
tggaagctcgtggaagagaagttcaagacaaaaaccgcgagcttcacctatggctgtctg
gatcctaccatggtcacccagatggtcaagtacttggacaccgtctacgtctctggatgg
caaagctcgtccaccgcctcctccaccgatgagccatcaccagatttggctgattaccca
atgaacactgtgccaaacaaggtcaaccaactatggatggctcagctcttccacgacaga
aaacaacgtgaagaaagactccgcaaccccaaagagaaacgcgcctctcttgccaatatc
gattaccttgctcctatcatcgccgatgctgacaccggccacggtggtttgactgccgtc
atgaagttgacaaagctcttcatcgagaggggtgccgctggtatccatattgaggaccaa
gctcccggaacgaagaagtgtggacacatggctggcaaagttttggtgcccatcagcgag
catattaaccgattggttgccatccgcgcccaggctgatatcatggggaccgaccttctt
gccattgccagaactgattccgaggccgcgaccctcatcacttccaccatcgacccgcgc
gaccacgctttcgtcgtaggctccacgaacccgaccctcgaacccttgaacgacctcatg
atcgccgccgagcgcgccggaaagaacggtgccgagctccaagctattgaggacagctgg
atcgccaaggccggtctcaagcgcttcgaagacgccgtcatcgaccagatcaaggcctcc
tccgccgccaacaagcaagccaccatcggcgctttcctgcgcgaaatcaagggcaagagc
aacaaagaagcacgcgccatcgcgcgccagatcctcggcaccgacatcttctgggactgg
gacgctccacgcacgcgcgaggggtactaccggtaccaaggcgggtgccagtgcgcgatc
aaccgcgctgtggcgttcgctcccttcgccgacctcatctggatggagagcaagctgcca
gactacgcacaggccaaagaattcgccgagggcgtgcacgccgtgtggccgcagcagaag
ctcgcgtacaatctctccccctcgttcaactggaaagcggcgatgccgcgcgacgagcag
gagacgtacattcgccgcctgggcgagctggggtactgctggcagttcatcacgctggcg
ggcctgcacaccaccgcgctcatctcggaccagttcgccaaggcgtacgccaagcagggg
atgcgggcgtatggcgagttggtgcaggagccggagatggagaacaaggttgacgtcgtg
acgcatcagaaatggagcggggcaaactatgttgatgagctgttgaaaatggtcactggt
ggtattagcagcactagtgccatgggtaagggcgtgaccgaggatcagttcaaataa

DBGET integrated database retrieval system