KEGG   Coccidioides posadasii: CPC735_045500Help
Entry
CPC735_045500     CDS       T01332                                 

Definition
Mitogen-activated protein kinase SLT2/MPK1, putative
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
cpw  Coccidioides posadasii
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CPC735_045500
Enzymes [BR:cpw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CPC735_045500
Protein kinases [BR:cpw01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CPC735_045500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 439 aa AA seqDB search
MADLQGRKVFKVFNQDFIVDERYNVTKEVGQGAYGIVCAASNVQTGEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDHFNEVYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSIDPDE
NAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHYLGTPNEETLRRIGSPRAQDYVRNLPYMQKVPFQRLFPNANPEALDLLDRMLAFDPS
SRISVEEALEHPYLQIWHDASDEPTCKTTFDFHFEVVEDVHDMRKMILDEVMRFRAHVRQ
PHIQMGNAGQQAAAQQTSVPIPEENITSWKQDEPRPQEAIHGGMQPNDLEASLQGGMDAM
RTHELQFDERWMVTKYIYA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcagatttacaaggacgtaaggtgttcaaggtgtttaaccaggatttcatcgtcgac
gaacggtacaatgtcacaaaggaggttgggcaaggtgcttatggaattgtttgtgccgca
tccaacgtacagaccggcgagggcgttgctatcaaaaaggtcaccaatgtcttcagcaag
aaaatcttggccaagagagccctgcgagaaattaaactgttgcaacatttccgcggtcat
cgcaatatcacctgcctctacgacatggacattccaagaccagaccacttcaacgaggtc
tatctctatgaagaacttatggaatgtgatctggctgccatcatccgttccggccagccc
ctgaccgatgctcacttccaatcttttatctatcagattctttgtggactgaaatacatt
cactccgccaacgttttacaccgtgatttaaaaccaggaaacctcttggtcaacgctgac
tgcgagctcaagatctgcgattttggtcttgctcgtggtttctcaattgatccagatgaa
aacgctggatacatgactgaatatgttgcgacgagatggtaccgtgctccagagatcatg
ttgagcttcccgagctacacgaaagctattgacgtgtggtctgtcggttgcattcttgca
gaattacttggcggaagaccttttttcaaaggtcgtgattacgttgaccaactgaatcag
atccttcattatttggggactccaaatgaagagacccttcgccgcattggatccccacgt
gcacaggattatgtccgcaatttaccatacatgcagaaagttccttttcaacgattgttc
ccgaatgcgaacccagaagctttggacctacttgatcggatgttggcgttcgatccctca
tcccgtatctcggtcgaagaagctcttgaacacccttatttacagatttggcatgacgca
tccgacgagccgacttgcaaaactacatttgacttccactttgaagttgtcgaagacgtt
catgatatgcgcaagatgattttagacgaggttatgcgattccgtgcacatgtgcgacaa
ccacatattcaaatgggaaatgcgggacaacaggctgcagcgcagcagaccagtgtccct
atacccgaagaaaacataacatcttggaaacaagacgaaccacggcctcaggaggccatt
catggggggatgcagcctaatgatcttgaagcctcgttacaaggaggtatggatgctatg
cggactcatgaattgcagtttgacgaacgctggatggttacaaaatacatttatgcataa

DBGET integrated database retrieval system