KEGG   Coccidioides posadasii: CPC735_046750Help
Entry
CPC735_046750     CDS       T01332                                 

Definition
WD-repeat protein mip1, putative
Orthology
K07204  
regulatory associated protein of mTOR
Organism
cpw  Coccidioides posadasii
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1421 aa AA seqDB search
MRDPKLDMYMNAKPQSQTAEQMQGQVQNKSVRVSFEPQVESYDSLTPELRPPALSHHRSQ
TVNFEGNGHIDVSNSASGTATPASGQASARIAEPVMRSARPTSTLVRAKSDHWLKSDGEN
DAKKDDDEDFELRHGWQEEYNSSEYLKILNSNFYMYFNEKRHDTGGIPKEQTGSWLQQDW
RMRDRLKTVSAALAICLNIGVDPPDVVKTNPSAKLECWVDPTSSGGAQNKVMEQIGKKLQ
EQYETLSLRTRYKQYLDPSVDETKKFCISLRRNAKDERVLFHYNGHGVPLPTPSGEIWVF
NKTYTQYIPVSLYDLQSWLAGPSLFVFDVSHAGHIVSNFHKFVEKHEKENVEARRKDANA
PIQNYSDCILLAACDKTESLPTNPDLPADLFTCCLTTPIQIALRYFMLQNPLQCGVPPDE
IKVPGRLQDRRSPLGELNWIFTAITDTIAWNTLPRALFKKLFRQDLMVAALFRNFLLSER
IMRTHECRPISSPELPETHTHPLWQSWDLAVEMVLSQLPALLEHEEGKRHYEYQHSSFFS
EQLTAFEVYLSSGPTESNPPDQLPIVLQVLLSQAHRLRALILLSKFLDLGPWAVHLALSI
GIFPYVVKLLQSAAQELKPVMVFIWARIMAVDHTVQNDLLKDNGIHYFITILNPSIGIPV
GNVSEHRAMCAFIISIFCKEYPQGQNVCLSPELIEFCLHHLMDVENPLLRQWCCLCISML
WNNFAEAKWMGIRCSAPARLCELTMDPVPEVRAAMLHALTSFVGIPDLTDQVAQVEEYLA
TAIVPMGNDGSALVRRELLVFLSTFVKRYQNKFLVTGYEQLLEEKHLLKHSVSGSKDTQP
PPFRDHGVSHNTIYGSLWKLLLILSVDPQEEVAQDAGVVVDYVYKILFDSPVGSLAQDVR
DEVLALHRRSRSKKPQPSESVEVKKIRPETPPAQIPSKQEGYLSLSLRRTASVAASLKNL
AFGSAATIDQRPSSPLNPSGRQTMAKNRMTITPRGRAPPEWTRPPEVNDQPVSAGQYGQA
PTPPSRGVNPRDLTKEPSIPLKSNFLEWSTEYFREPQMKPNEPDEPGSADYNQRLWRRAR
NERIIVETQQLKDKGGSGRWDVALTLMSNPSQPAKMCFHQFEDHLAVADDRDTICIWDWE
SNSRLSRFSNGNPLGSRINEVRFINEDDQALLMTGSSDGVLKIFRNYESDRRIELITAFR
ALPELIPSNKNAGLVLDWQQGQGKALIAGDVKVIRVWNAATEVCTNDISARSGSCITSLT
SDQVAGNIFIAGFGDGAVRVFDQRLKPTTAMVKVWREHKQWITNVHMQRGGVRELISGSR
NGEVRLWDLRMDNSIDTIQATKDTLRTLSVHEHAPVFSIGTNRHEVKTFNVDGSYLSSFE
PHGSFLSQSRTSPVVGTAFHPHKMVMACSALYDNYVNLVSC
NT seq 4266 nt NT seq  +upstreamnt  +downstreamnt
atgagagacccaaagctagacatgtacatgaatgcgaaacctcaatcacagacagccgaa
caaatgcagggccaagtgcagaacaaatctgtgcgcgtcagtttcgagccacaggtcgaa
agttacgattctctgactccggaattacgccctccggcactgagccatcatagatctcag
acggtgaattttgaagggaatggccacatcgatgtctctaattcggcctctgggacagcg
actcccgcgtcgggacaagcgtccgcacgaatagctgagccagtaatgaggagcgcgagg
ccaacctctactcttgttcgagcgaaaagcgatcactggcttaagagcgatggagaaaac
gatgcgaagaaagacgatgatgaagattttgagctaaggcacggctggcaagaggaatat
aattctagtgaatacttgaagatattaaattcgaatttctatatgtatttcaacgagaaa
cgccacgataccgggggaatccccaaggaacaaacgggaagctggttacaacaggactgg
cgcatgagggatcggttaaagacagtatccgctgcgctcgctatttgccttaatattggc
gttgaccctccagatgttgttaagacgaatcccagcgcgaagctagagtgttgggtagat
ccaacctcatccggtggcgcacagaataaagtgatggaacagattggcaagaaactacag
gagcagtacgagactctaagcctccgaacccggtataagcagtatctagacccatcagtg
gacgaaacaaagaaattctgcatatcccttcgacggaatgcgaaagatgagagggtatta
tttcactacaatggccatggcgttcctctcccaactccatccggtgagatttgggtgttc
aacaaaacttatacacagtatatcccggtatcattatacgatcttcaatcctggcttgca
ggtcccagcctatttgtctttgacgtctcccatgcgggtcacattgtctccaatttccat
aaatttgtggaaaagcatgaaaaggagaatgttgaagctcgcaggaaagatgcaaatgct
cccattcagaactacagtgattgcatccttcttgctgcctgcgataagactgaatccttg
ccaactaaccctgaccttcctgccgatctgtttacctgttgtttgacaacccctattcag
atcgctcttagatacttcatgcttcagaatcccttgcaatgtggcgtcccgccggacgaa
attaaagttcccggacgcctgcaagaccgacgaagtccgctcggagaacttaattggatc
tttacagcaatcactgacaccattgcttggaacacccttcctcgtgctcttttcaaaaag
ctttttcgtcaagacctcatggttgcagctctattccgaaattttcttctcagcgaaagg
attatgagaacccatgaatgtcgcccgatctcctcacccgaactccctgaaacacatact
catcccttatggcagagttgggatcttgccgttgagatggtcctttcccagctacccgca
cttcttgaacacgaggagggaaagcggcattacgagtaccagcactcaagtttcttttct
gaacaactcacagcctttgaagtttacctctcatctggacctacggaaagtaacccacca
gatcagttaccaattgtcttacaggtgttattaagccaggcgcatcggctacgcgcgctg
atcctcctgagcaaatttcttgacctcggtccctgggcggttcatctagcactgagcata
ggaatatttccgtacgtggtgaaattattacagagtgccgcgcaggaacttaaacccgtc
atggtgttcatatgggcgcggatcatggcagtggaccatacggttcagaacgacttgctt
aaggataatggcatccattactttataactattcttaatccctctatcggtatcccggtg
ggtaatgtgagtgagcatcgggcgatgtgcgcctttattatcagcatcttttgcaaggaa
taccctcaaggccaaaacgtgtgtctctcgccagaattgatcgaattctgtcttcatcac
ctgatggatgtcgagaatccactgttgcgacaatggtgctgcctttgtataagcatgttg
tggaataattttgctgaggcaaagtggatgggaatccgatgctccgcgccagcacggctt
tgcgagctcactatggaccccgtcccagaggtccgagcagcaatgcttcatgctctaacg
agcttcgttggtatccctgatttgacagaccaagttgcacaggttgaagagtaccttgcg
acagccattgttccgatggggaatgatggaagcgccttagtacgaagagaacttctggtc
ttcttatccacttttgtgaaaaggtatcagaacaagttcctggtgactggttatgagcaa
cttttggaagaaaagcatcttctcaaacactctgtttcaggctccaaggatactcagcca
ccaccattccgcgaccatggtgtttctcacaatacaatatatggatccctctggaaatta
ctacttatcctctcagtcgacccacaggaagaggtagctcaggacgccggagtagttgtc
gactatgtctacaaaattcttttcgattcaccagtgggaagcttagctcaggatgttcgt
gatgaggttcttgctctacatagacgttcgcgatctaagaaaccacagccttccgaatca
gttgaggtgaagaaaataagaccggaaacaccgccggcccagatccctagcaagcaggag
ggatatctttcattaagcttaaggaggacagcaagcgtggctgcatccttgaaaaacctt
gcatttgggtcggctgccaccattgatcagcgtccttcatcgcctcttaatccatctggc
aggcaaacaatggctaagaaccgtatgaccattactcctcgcggtcgtgcacctcccgaa
tggacacgaccgcccgaagtgaatgatcaaccagtttccgctggtcaatatggccaagca
cccacaccgccttcaaggggcgttaatcccagagatttaacgaaggaaccatcgatcccg
ctgaagagcaactttttggaatggtcgacagaatacttccgcgagccgcaaatgaaacct
aacgagccggatgaacctggcagcgctgattacaatcaaagactatggcggcgcgcccgg
aatgaaagaataattgtcgaaacacaacagctaaaggataaaggcggaagtggccggtgg
gatgtagcattaactcttatgagtaatccaagtcaaccggcaaagatgtgcttccaccag
ttcgaggaccacctcgcggttgctgatgatagagatactatctgcatatgggattgggaa
agcaactcccggctcagtcggttttctaatggcaacccactgggttcaaggatcaatgaa
gttcggtttatcaacgaagacgatcaagctctcttgatgactggctcttctgatggagtt
ttgaaaatattccgcaactacgagtctgatcggaggatagagctgattactgctttccgc
gcgctgcctgaactaatccctagtaataaaaatgccggcctcgtcttagactggcaacag
ggccaggggaaggcacttatcgctggagacgtaaaggtcattcgtgtttggaatgcagcc
actgaagtatgcacgaatgatatatctgctcgttccggctcctgtattacttctttaaca
tcggatcaagttgctggcaacattttcattgccggattcggtgacggcgctgttcgagta
ttcgaccaacgattaaaacccaccaccgcgatggtgaaagtctggcgagagcacaaacaa
tggattacaaacgttcacatgcaacgaggcggagtaagagaacttatatctgggagccgg
aatggtgaagtcagactatgggatctgagaatggataactccattgacaccattcaagcc
accaaggacacattaagaacgttgagcgtacacgagcatgccccagtgttttctattggt
accaaccggcatgaagtcaaaactttcaatgtcgacggatcgtacctctcttcattcgaa
ccgcacggtagcttcctctcccaaagccgcacttcgcccgtcgtcggcacggccttccat
ccgcataaaatggtcatggcatgctctgccctctatgataattatgtcaatctcgtttct
tgctga

DBGET integrated database retrieval system