KEGG   Coccidioides posadasii: CPC735_047770Help
Entry
CPC735_047770     CDS       T01332                                 

Definition
Ubiquitin carboxyl-terminal hydrolase family protein (EC:3.1.2.15)
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
cpw  Coccidioides posadasii
Brite
Enzymes [BR:cpw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CPC735_047770
Peptidases [BR:cpw01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CPC735_047770
Transcription machinery [BR:cpw03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CPC735_047770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 490 aa AA seqDB search
MADAVISVTPEFGCEHLREIIESNSRTAGQFYDSLLLVRESQSSLPQVFRELPQPRSAST
RRLSFKPLYQCLHCPASRSRDGRAAHREMTGHLFFADCRSGSIWCQGCDDFIYDSEVDRV
LWDTSRIIQRTDSTSKKRTIAETLADPDTEDASYLTSNSSKRLCGKDGVRGLYNLGQTCY
MNVIMQTLFHEPLLTSYFLGHGHRIYDCSEANCFVCQVAETFAEFNNDEKQEGFNCLNLL
LSSWQSSPDLAGYQQQDAHEFYQFLVNKLHATAEDRVDGYDQRCRCFFHKAFFGKLQSSV
TCHNCGNTNRTEDPIMDLSLAFQVQRKKKALHWTPGESDTTPTLNGCLESYTAPEELPAS
DYSCSWCGTPQGATKQLRLRNLPVILCMQLKRFERHRSVSEKVDAKVSFPLSINMAPYTT
RSHSKNVLKYTYDLLSVVVHIGDIDSGHYLAYCRQGELWFKFNDDRVTWATEAEVLDADA
YLLFYTLRSL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgctgttattagcgtgacaccagaatttggctgtgaacacctcagggaaata
attgagagcaactctagaactgctggccagttctacgattcccttctccttgtgcgggaa
tcccagtcctcgctacctcaagtgttccgggagcttcctcagccacgctccgcttccaca
cgacggttgtctttcaaaccattatatcagtgcctgcactgcccggctagtcgatcgcgg
gacggtcgagcggctcatcgggagatgaccggtcatttattcttcgctgactgccgaagt
ggatcaatatggtgtcaaggctgtgatgacttcatatacgacagtgaggtggacagggta
ctatgggatacgtctagaataatccagcgcacggattcgacttcaaagaagcgcactatt
gctgagactctagccgaccctgatacagaggacgcttcctacttgacatctaacagtagc
aaacggctctgtgggaaggatggcgtgagaggcttgtataaccttggccagacgtgttac
atgaacgttattatgcagacattgttccatgagcccctgctcacatcttattttctcgga
cacggtcatcgcatctatgactgttccgaggcgaactgttttgtgtgccaagttgcagag
acattcgcagaatttaataacgatgaaaaacaagaaggattcaactgcctgaatctgctg
ttgagttcatggcaatcatcccctgaccttgccgggtatcagcaacaagatgcccatgaa
ttctatcagtttcttgtcaataaactccatgccacagccgaggatcgagttgacggatat
gaccagagatgccgttgcttcttccataaagcgtttttcggcaagttgcaaagcagcgtg
acctgccataactgtggaaacacaaaccgcactgaagacccaatcatggacctaagtctt
gctttccaggtacagaggaagaagaaagcattgcattggacgcctggagagtcggatacg
acgccaaccctcaacggctgcttagagagctacacagctcctgaagaattgcctgcgagc
gattacagttgcagctggtgcggaacaccacaaggagctacgaagcaacttagacttcga
aatttgccggtgatattatgcatgcagctcaagcggtttgagcgacatcgctccgtctcg
gagaaggtagacgccaaagtttctttcccgctgtcgataaacatggcgccgtacaccaca
cgctctcactctaaaaatgtcttgaagtatacctatgacttgctaagtgtggtagtccac
ataggggacattgactctggtcactatcttgcttattgccggcagggcgaactgtggttt
aagttcaacgatgatcgagttacgtgggctactgaggcggaggtgctggatgccgacgct
tatctgttattctataccttgcgctctctttaa

DBGET integrated database retrieval system