KEGG   Coccidioides posadasii: CPC735_048520Help
Entry
CPC735_048520     CDS       T01332                                 

Definition
Formamidopyrimidine-DNA glycosylase N-terminal domain containing protein (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cpw  Coccidioides posadasii
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:cpw03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 416 aa AA seqDB search
MPELAEVARIVHFIRKELVGKTVSSAVANHDDLIFGKVGTSAQEFQKTMQGNKIIGAGQQ
GKYFWMIMSKPPHPVMHFGMTGWLNIKGVNGCHYRAKEEEGDGPWPPKFWKFRLVMDDDK
KTEAAFVDARRLGRVRLVDCPGEEIRSHTPLKENGPDPVTDKGIVTESWLKSIVSKKKVP
IKALLLDQSIMSGLGNWMADEVLYHSQIHPEQTSNTLDDSQIRELNSAIHYVCATSVDLL
GDSARFPADWLMHHRWNKGKKEPSKMLNGDPVTFITVGGRTSAIVPAVQKKTHPTATNDK
GGNAKEDVDDESATKSRSKGRGKATVKETDETTTTNGNKRSTRISKASSVKAEEEKNTEG
NDSAAQTPSRKRKAPAVKSEAAENAAGIAKKTRGNATKEAPSTTAPLRRGRSAAKK
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagctagccgaagttgcccggattgttcatttcatccggaaagaacttgtggga
aagacggtctccagtgccgtggcaaaccacgacgatctcatattcggcaaagtaggcacg
tctgcccaggaattccaaaagactatgcaagggaacaagattattggagctgggcaacaa
ggcaaatacttctggatgatcatgtctaaacccccgcatccggtcatgcattttggtatg
accggttggctcaatatcaaaggcgtaaacggctgccattatcgcgccaaggaggaagag
ggtgatggaccgtggccaccgaagttctggaaattccggctggtgatggacgatgacaag
aagactgaagctgcctttgtagatgctaggaggctcggccgtgttcggttggttgactgc
cctggagaagaaatcaggtctcacacgccactcaaggagaacggtcccgatcctgttaca
gacaagggaattgtcacggaatcgtggctcaagagcatagtgtctaagaagaaagttcct
atcaaggccctactcctggatcagtctataatgagtgggctgggcaactggatggctgac
gaggtcctttatcactcacaaattcatcccgagcaaacgagcaataccctcgacgattca
cagattcgggagctgaactctgcaattcattatgtgtgcgctacatcggtcgatctcctt
ggtgattccgctcgctttcctgcagattggctgatgcatcatcgatggaacaaaggcaag
aaagagccgtcaaagatgctaaacggtgatcccgtaacttttatcacggttggaggcagg
actagcgccatagtgccagcagttcagaaaaagacgcatcctaccgccacaaacgacaaa
gggggaaacgccaaagaggatgtcgacgatgaatctgctacgaagtcgcgatccaagggc
cgtggaaaagctactgttaaagaaacagatgagaccacaaccactaatggaaacaaaagg
agtacccgaatctcaaaggcttcttcggtcaaggccgaggaagagaagaacaccgaaggg
aacgactcggcagcgcaaactccaagccgaaagcgcaaggctccagccgtgaaatctgaa
gcagctgagaatgcagcgggaatagccaaaaagaccagaggtaacgccacgaaggaagct
ccgtctacaacggcacccttgagaagagggcgctcagctgccaaaaaataa

DBGET integrated database retrieval system