KEGG   Coccidioides posadasii: CPC735_049070Help
Entry
CPC735_049070     CDS       T01332                                 

Definition
glucoamylase precursor, putative (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
cpw  Coccidioides posadasii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cpw00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 617 aa AA seqDB search
MMLSILRALYAVPLVYSLVSGSEAKFALRQEETLEQWLETESSYALQSILDNIGDDGAKV
QGAHAGIVVASPSRADPDYFYTWTRDAALVFKHLIDAFVAGNHDSQDRIHKYITAQSYLQ
TVSNPSGTLSTGGLGEPKFHVDQSAFTGSWGRPQADGPALRATAMITYAKWLIANGHEDA
AKSIVWPVVQNDLSYVGQFWNSTGFDLWEEVQGSSFFTAIAQHRALAEGNNLARQLGTDC
PHCESQAPQILCFLQSFWTGSNIIANFGGDRSGLDANSLLGIIHNFDPEADCDDNTFQPC
SSRALANHKKVTDSFREIYPINSGMEGDQAVAVGRYAEDVYYGGQPWYLATFASAELLYD
AIYQWNHTGKITITDVSLPFFQSIYKSAHVGTYSSSTNVFSEIIANVGSYADGYLNVARK
YTPCSGALAEQFSRNDGTPLSASDLTWSYAALLTAKERRESVVPGSWGQKSAHDIPPTCL
ATSAAGSFQAATITGWPSTLTPTPTNPAPCPTPSSVKITFQSVTDTKWGENIFLVGSIPE
LGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGKKFDYKYIRKSDDGRVVWESDPNRSYT
VPKKCRVSSLVLKSTWR
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgatgctatccatcctcagagcgttatacgccgtccctctggtctatagcctggtcagc
ggttcggaggcaaagttcgcactgcggcaagaagagaccttggagcaatggcttgaaacg
gagagctcatatgccctccaatctattcttgacaatatcggggacgacggggcgaaagtg
cagggtgctcatgctggtattgtcgttgcgagcccgagcagggctgatccggattatttt
tatacatggactcgagacgccgccctcgtcttcaaacacctaatcgatgcttttgttgct
ggaaaccatgactcgcaggatcgcatccacaaatatatcaccgctcaatcatatttacag
accgtgtcgaatccatctggaactttgtcgactggtggactcggtgagccaaagtttcat
gtggatcaatctgcgttcacagggagctggggccggcctcaggcagacgggccggctctg
agagccactgcgatgattacctacgcgaaatggcttatcgccaatgggcatgaagatgcc
gcgaaatccatcgtatggccggtcgtgcagaatgatctgtcgtacgttggccagttctgg
aactctactggatttgacctatgggaagaagttcagggatcgtcgttcttcacagcaatc
gcacaacatcgtgcgctcgcagaaggcaacaaccttgcccgccagcttgggacggattgt
cctcactgcgagtcgcaagcaccacaaatactttgcttcttgcagtcattctggaccggg
tccaacatcatcgcgaatttcgggggagacagatccggtcttgacgcaaactcccttctt
ggcatcatccataacttcgatccagaggcggattgcgatgataatacattccagccgtgc
tcgtcgagagcacttgcgaatcacaagaaggttacggattcttttcgtgaaatataccca
ataaattctggcatggaaggtgatcaggctgttgccgttggtcgatatgctgaagatgtt
tactatggaggacagccgtggtacctcgcgacgtttgcctctgccgagctcttgtatgat
gctatttaccaatggaatcatacgggcaagattaccatcaccgatgtgtcattgccattt
ttccaaagcatttacaagtcagctcatgttggaacttattcctcctcaactaacgtcttc
tctgagatcattgccaatgtcgggagctatgccgacgggtacttgaatgttgcaagaaag
tacacgccttgctctggggcactagctgagcagttctcaagaaacgatgggacaccacta
tctgcgagtgacctgacttggtcgtacgctgctcttttgacagcaaaagagagacgggaa
tcggttgtgccgggatcatggggtcaaaaatctgcgcacgacattccaccgacctgcttg
gcaacatcggcggctggaagttttcaagccgcgaccataacagggtggccttcaactctg
actccaactccaaccaacccggcaccatgcccaaccccaagcagtgtcaaaatcactttc
cagtcggtcaccgacacaaaatggggcgaaaacatttttctcgttgggtctattccagaa
ttaggatcatgggagcccagtgcggcaaaacaactgaaagcggacaagtacgaagcctct
tgtcccctgtggtccattcagattgatctcgccgcggggaagaaattcgattacaaatat
atccggaagagtgacgacggaagggtagtgtgggagagtgatccgaatcgatcatatact
gtcccgaagaagtgcagagtttcgtctctggttctgaagagcacttggcgctga

DBGET integrated database retrieval system