KEGG   Coccidioides posadasii: CPC735_049370Help
Entry
CPC735_049370     CDS       T01332                                 

Definition
acetate--CoA ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cpw  Coccidioides posadasii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPC735_049370
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPC735_049370
   00620 Pyruvate metabolism
    CPC735_049370
   00640 Propanoate metabolism
    CPC735_049370
  Energy metabolism
   00680 Methane metabolism
    CPC735_049370
Enzymes [BR:cpw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CPC735_049370
Lipid biosynthesis proteins [BR:cpw01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CPC735_049370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 691 aa AA seqDB search
MSETPAEPKPPVVVEAHQVDTFDVPGVFYENHPHEPHLSGMNEYNQLYQQSINDPDTFWA
RMARDLITFEKDFDKTHIGTLEGGDNAWFVGGRLNASFNCVDRHAMRDPNKVAIIYEADE
PGHGRSITYAELLKEVSRLAWVMKSQGVRRGDTVAIYLPMIPEAIFALLACARIGAIHSV
VFAGFSSDSLRDRTLDARSKFIITTDEGKRGGKVIGTKKIVDEALKQCPDVTSCLVFKRT
GADVPWTKGRDLWWHEEVEKYPNYLPAESMDSEDPLFLLYTSGSTGKPKGVMHTTAGYLV
GAAATGKYVFDIHPADRFFCGGDVGWITGHTYVVYAPLLLGCTTVVFESTPAYPNFSRYW
DVIEKHKVTQFYVAPTALRLLKRAGDHHINHEMKDLRILGSVGEPIAAEVWKWYHEVVGK
RQAHIVDTYWQTETGSHVITPLGGITPTKPGSASLPFFGIDPVILDPVTGAEIPGNDVEG
ILAFRKPWPSMARTVWGDHKRYMDTYLNVYKGFYFTGDGAGRDHEGYYWIRGRVDDVVNV
SGHRLSTAEIEAALIEHHCVAEAAVVGVPDPLTGQAVHAFVALKSGNDNREQLRKELIMQ
VRKSIGPFAAPKVVFVIDDLPKTRSGKIMRRILRKILSGEEDSLGDISTLSDPSVVNKII
DTFHEWKRAMAAAAAAAAAVSATAPPNSTTG
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagacgcctgctgaaccaaaacccccagtggtcgtggaggcccaccaggtcgat
accttcgacgttccaggagtcttctatgagaaccacccccatgaaccacacctgagtggc
atgaatgaatataaccagctctaccaacaatctatcaatgatcctgacaccttctgggcg
cgcatggcgcgcgatcttattactttcgaaaaggatttcgacaagactcacattgggacc
ctcgaaggcggggataatgcctggtttgtcggtggtcgattaaatgcgtccttcaactgc
gttgatcgccatgcaatgcgtgacccgaacaaggttgcaatcatctatgaagccgatgag
cctggccacggccgcagtattacctatgcagaattgttgaaggaagtctccagactggcc
tgggtgatgaagagccaaggtgttaggagaggcgataccgtcgcgatttatcttcctatg
atccctgaggccatcttcgcgcttcttgcctgtgcgcgtattggcgccattcattctgtg
gtctttgcgggtttctcttccgattccctgcgtgatcgtaccctggatgcccggtcaaaa
ttcattatcaccaccgatgagggaaagcgtggtggaaaagtcattgggactaagaaaatt
gttgatgaagctttaaaacaatgcccagatgttaccagttgccttgttttcaagagaact
ggggccgacgtgccttggaccaaaggccgtgacctgtggtggcatgaagaggttgaaaaa
tatccaaattatctgcctgctgagtcaatggactctgaagacccgcttttccttctctac
acatctggctccaccgggaaaccaaagggtgttatgcacacaactgctggctaccttgtt
ggagcagctgcaactggaaaatatgtctttgatattcacccagctgaccgtttcttttgc
ggtggtgatgttggatggattactggacatacttatgttgtctatgctccattgcttttg
gggtgcactactgtggtgtttgaaagcacaccagcgtatcccaatttctcgcgatactgg
gatgttattgagaagcacaaggtcacccagttttatgtagcacctacggctttgcgcctt
ttgaaacgtgcaggtgaccaccacataaaccatgaaatgaaggatttacgtattctgggc
tctgttggtgaaccaatcgctgcagaggtttggaagtggtaccatgaggttgttgggaaa
agacaagcccatattgttgatacatactggcaaaccgagaccggctcccatgttatcacc
cccttgggtggtattactccaactaaaccagggagtgcttcgcttccattctttggtatt
gaccctgtcattctggatccagttacaggtgcagagattccgggaaatgatgtggaggga
atccttgctttcagaaagccatggccaagcatggctcgcactgtatggggcgatcataaa
cgatacatggacacctatctcaatgtttataaaggcttttatttcactggtgatggtgct
ggacgtgatcatgaaggctattactggattagaggtcgtgtggatgacgttgtgaacgtc
tctggccaccgcctctcaactgcagagatcgaagcagcacttatcgaacaccactgtgtt
gcggaagccgcggttgttggagttcctgatccgctaactggacaagccgtgcatgcattt
gtggccctgaagagtggaaatgacaatagagaacagctccgaaaggagttgattatgcaa
gtccgcaaatcgattggaccatttgctgccccgaaggttgtgtttgtgatcgatgacctt
ccgaaaacacgtagcgggaagatcatgagacgcatcttgcgaaagattctgagcggtgag
gaggacagtcttggtgacatttcaacgctctcggatcctagcgtcgtgaataaaatcatc
gacactttccacgaatggaaaagagctatggcagctgccgccgccgccgctgctgctgtc
tcagcaaccgcgccaccaaacagcacaaccggttaa

DBGET integrated database retrieval system