KEGG   Coccidioides posadasii: CPC735_049370Help
Entry
CPC735_049370     CDS       T01332                                 

Definition
acetate--CoA ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cpw  Coccidioides posadasii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cpw01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cpw00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cpw00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cpw00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:cpw00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 691 aa AA seqDB search
MSETPAEPKPPVVVEAHQVDTFDVPGVFYENHPHEPHLSGMNEYNQLYQQSINDPDTFWA
RMARDLITFEKDFDKTHIGTLEGGDNAWFVGGRLNASFNCVDRHAMRDPNKVAIIYEADE
PGHGRSITYAELLKEVSRLAWVMKSQGVRRGDTVAIYLPMIPEAIFALLACARIGAIHSV
VFAGFSSDSLRDRTLDARSKFIITTDEGKRGGKVIGTKKIVDEALKQCPDVTSCLVFKRT
GADVPWTKGRDLWWHEEVEKYPNYLPAESMDSEDPLFLLYTSGSTGKPKGVMHTTAGYLV
GAAATGKYVFDIHPADRFFCGGDVGWITGHTYVVYAPLLLGCTTVVFESTPAYPNFSRYW
DVIEKHKVTQFYVAPTALRLLKRAGDHHINHEMKDLRILGSVGEPIAAEVWKWYHEVVGK
RQAHIVDTYWQTETGSHVITPLGGITPTKPGSASLPFFGIDPVILDPVTGAEIPGNDVEG
ILAFRKPWPSMARTVWGDHKRYMDTYLNVYKGFYFTGDGAGRDHEGYYWIRGRVDDVVNV
SGHRLSTAEIEAALIEHHCVAEAAVVGVPDPLTGQAVHAFVALKSGNDNREQLRKELIMQ
VRKSIGPFAAPKVVFVIDDLPKTRSGKIMRRILRKILSGEEDSLGDISTLSDPSVVNKII
DTFHEWKRAMAAAAAAAAAVSATAPPNSTTG
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagacgcctgctgaaccaaaacccccagtggtcgtggaggcccaccaggtcgat
accttcgacgttccaggagtcttctatgagaaccacccccatgaaccacacctgagtggc
atgaatgaatataaccagctctaccaacaatctatcaatgatcctgacaccttctgggcg
cgcatggcgcgcgatcttattactttcgaaaaggatttcgacaagactcacattgggacc
ctcgaaggcggggataatgcctggtttgtcggtggtcgattaaatgcgtccttcaactgc
gttgatcgccatgcaatgcgtgacccgaacaaggttgcaatcatctatgaagccgatgag
cctggccacggccgcagtattacctatgcagaattgttgaaggaagtctccagactggcc
tgggtgatgaagagccaaggtgttaggagaggcgataccgtcgcgatttatcttcctatg
atccctgaggccatcttcgcgcttcttgcctgtgcgcgtattggcgccattcattctgtg
gtctttgcgggtttctcttccgattccctgcgtgatcgtaccctggatgcccggtcaaaa
ttcattatcaccaccgatgagggaaagcgtggtggaaaagtcattgggactaagaaaatt
gttgatgaagctttaaaacaatgcccagatgttaccagttgccttgttttcaagagaact
ggggccgacgtgccttggaccaaaggccgtgacctgtggtggcatgaagaggttgaaaaa
tatccaaattatctgcctgctgagtcaatggactctgaagacccgcttttccttctctac
acatctggctccaccgggaaaccaaagggtgttatgcacacaactgctggctaccttgtt
ggagcagctgcaactggaaaatatgtctttgatattcacccagctgaccgtttcttttgc
ggtggtgatgttggatggattactggacatacttatgttgtctatgctccattgcttttg
gggtgcactactgtggtgtttgaaagcacaccagcgtatcccaatttctcgcgatactgg
gatgttattgagaagcacaaggtcacccagttttatgtagcacctacggctttgcgcctt
ttgaaacgtgcaggtgaccaccacataaaccatgaaatgaaggatttacgtattctgggc
tctgttggtgaaccaatcgctgcagaggtttggaagtggtaccatgaggttgttgggaaa
agacaagcccatattgttgatacatactggcaaaccgagaccggctcccatgttatcacc
cccttgggtggtattactccaactaaaccagggagtgcttcgcttccattctttggtatt
gaccctgtcattctggatccagttacaggtgcagagattccgggaaatgatgtggaggga
atccttgctttcagaaagccatggccaagcatggctcgcactgtatggggcgatcataaa
cgatacatggacacctatctcaatgtttataaaggcttttatttcactggtgatggtgct
ggacgtgatcatgaaggctattactggattagaggtcgtgtggatgacgttgtgaacgtc
tctggccaccgcctctcaactgcagagatcgaagcagcacttatcgaacaccactgtgtt
gcggaagccgcggttgttggagttcctgatccgctaactggacaagccgtgcatgcattt
gtggccctgaagagtggaaatgacaatagagaacagctccgaaaggagttgattatgcaa
gtccgcaaatcgattggaccatttgctgccccgaaggttgtgtttgtgatcgatgacctt
ccgaaaacacgtagcgggaagatcatgagacgcatcttgcgaaagattctgagcggtgag
gaggacagtcttggtgacatttcaacgctctcggatcctagcgtcgtgaataaaatcatc
gacactttccacgaatggaaaagagctatggcagctgccgccgccgccgctgctgctgtc
tcagcaaccgcgccaccaaacagcacaaccggttaa

DBGET integrated database retrieval system