KEGG   Coccidioides posadasii: CPC735_050890Help
Entry
CPC735_050890     CDS       T01332                                 

Definition
3',5'-bisphosphate nucleotidase, putative (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cpw  Coccidioides posadasii
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CPC735_050890
Enzymes [BR:cpw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CPC735_050890
Transfer RNA biogenesis [BR:cpw03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CPC735_050890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 356 aa AA seqDB search
MSYQQELLVAQLAVQRAAILTQKVFYEKTKGTLSKDDFSPVTKGDFGAQALIIQAIRANF
PQDEVVGEEDADSLRENDALRNEMWNLVKDIKLTDAESDKVIGGPFKNETEMLDALDGGK
SPGGPKGRIWALDPIDGTKGFLRGGQYAVCLGLIEDGDVKVGVIGCPNLPLDDSAPLSAE
IGQSGAAGTETGVLFSAVKGQGATSRPLSDGAVREGKAISMRPVTDITKACFCEGVEAGH
SAQDDNAEVARRLGINSPSVRLDSQAKYCSIARGAGDIYLRLPVRADYEEKIWDHAAGDL
IVREAGGEVTDITGNRLDFTKGRKLSANRGVVAAPKSIFEQVINAVRAVYAAKASI
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtcttaccaacaggagctgttggtggcccagctggcggtgcagagagccgccattttg
acccagaaggtattctacgagaagaccaaaggaactctttcaaaagatgatttttcccct
gtgacgaaaggagattttggcgcccaggccttgatcatccaagccattcgcgcgaacttc
ccccaggatgaagtcgtgggagaggaagatgcggactcgctccgggagaacgacgccttg
agaaatgagatgtggaatctcgtcaaggacatcaaactcaccgatgctgaaagcgacaaa
gttatcggcggaccctttaagaatgagaccgagatgcttgacgcccttgacggcggcaag
agccctggtggccccaaaggcagaatatgggcattggaccccatcgatggcaccaagggc
ttcctccgaggtggtcagtatgctgtctgccttggtctcatagaggatggcgacgtcaaa
gttggcgttatcggatgtcccaaccttccactcgatgactctgcacccctttccgctgag
attggacagtccggcgccgctggcacggagaccggagttctcttctctgctgtgaaggga
caaggtgccacgagtcgcccgctttcggacggtgcagtgcgagagggcaaagcaatttcg
atgaggccggttacggatattacaaaggcttgcttctgcgagggagtcgaggccggtcac
tccgcccaggacgataatgccgaggtcgccagacgcctcgggattaactcgcccagcgtg
cgcttggactctcaggcgaagtattgttcaattgcacgcggcgccggcgacatttacctc
agattgccagttagggccgactatgaagagaaaatctgggatcacgccgcgggagacttg
attgttcgggaagctggaggcgaggtcactgatatcaccggcaacagactcgacttcacc
aagggcaggaaattatcagcgaacaggggtgtggtcgcggccccgaagtctattttcgag
caggtcatcaacgcagtccgcgccgtctatgctgccaaggcatcaatttag

DBGET integrated database retrieval system