KEGG   Coccidioides posadasii: CPC735_052650Help
Entry
CPC735_052650     CDS       T01332                                 

Definition
protoporphyrinogen oxidase family protein (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cpw  Coccidioides posadasii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cpw00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 582 aa AA seqDB search
MRSRCSSAHAVEELWTLAQAHRFSTRPRVVFSKHLRNRTRLNFSSTASNDTRNVAVIGGG
ITGLATAYHLAKDQSTKVTIWERSDRLGGWLDSERINVNIGGDVLFDYGPRTLRATASAF
STLELINEFGLEKQILRTGIHDAASRNRYIYYPDHLVRLPGPQPGAGLLVNLISNAIGVF
TEPALKSLPWALATEPLRPSRPKDLDDESVGDFVARRLGKDVADNIVSAVFHGIYAGDIY
KLSVKTILPRIWEYEISRRGIFGSLLNTKRTLHLPYDLYHEGKIIREEKGKEFLSKIGSY
ISGASVFALKGGMGQLVEALDTSLSNSPNVEIITGSSVDHIERRDTQWRIGAKDYNCVVS
TTSSAELRRQIAPILTNTGALVALESHNYAVNVMVVNFFFRSPNLVPVHGFGYLIPRSIP
LEQNPERALGVVFMSDSNVGQDTARGTKLTVMIGGHWWDGWRDGDFPDERSGIQMAKAVL
KRHLHINEEPIVAKAKLLKNAIPQYTVGHTARMKDLHFSLSHVAPGIRLAGAWYTGVGVN
DCTRAARLTAHSILSGKREETGLEKYLDENVAGYELPLGSSG
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcgcgatgttcgtccgcccatgcagttgaagagctatggacgcttgctcaagca
cacaggttttccaccaggccacgcgttgtattttcgaagcacttaaggaaccgaactcga
cttaatttctcatccacagctagcaatgacacaagaaatgtcgcagtaatcggtggcggc
attaccggccttgcaactgcttatcatcttgcaaaagaccaatcgactaaagtcacgatc
tgggagcgctcagatcgtctaggcggatggctggattctgagaggatcaacgtcaatatt
ggtggagatgtgcttttcgactatggacctcgcaccctccgtgcgacggcgagtgcgttt
tccactctcgaactgataaacgagttcggtctcgaaaagcagatccttcgtacgggcatt
catgacgctgcttcgcgcaaccgctacatttattacccagaccaccttgtccgcctacca
ggaccgcaacccggggccggcctgctcgtaaacctcatctccaatgctataggcgtattt
acggaaccggcgttgaagagcttaccatgggcgctggcgaccgagcccttgagaccctct
cgtcccaaagatcttgatgacgaatccgtgggagatttcgtagctaggagattggggaaa
gacgttgctgataatatagtttccgctgtctttcatggtatctatgctggtgatatatat
aagctcagtgtcaagacaatattaccccgtatttgggagtatgaaatatcgaggcgtggc
atctttgggtcgttgctcaacactaagaggacgctacatctcccgtacgatctttaccac
gagggaaaaataatcagggaagagaaaggaaaagaatttcttagtaaaatcggctcctac
atctctggtgctagtgtctttgccttgaaaggggggatgggacagctggtcgaagccttg
gatacgtcgctttccaactctccaaacgttgagataattacgggttcaagtgtcgatcac
atagagcggcgtgatactcaatggcggattggagcgaaggactacaattgtgtcgtctcg
actacttcgtctgctgagctccgccgacaaatagctcccattctgacaaatactggagcc
ctcgtggcgcttgaaagtcataattacgccgttaacgtaatggttgtcaatttcttcttc
aggtctccaaacctggtgcccgtccacggtttcggttacctgattcctcgttctataccc
ctggaacaaaaccctgaacgtgccttgggtgttgtgtttatgtccgattccaacgtcggt
caagacacagcacggggtactaagctcaccgttatgataggaggccactggtgggacggg
tggagagacggggattttcccgatgagcggtcgggaattcaaatggccaaagcagtgctg
aagcgtcatctacatattaatgaggagccgattgttgccaaggcgaaactgctgaaaaat
gcaattccgcagtatacggttggacatactgctcggatgaaggacctgcatttttcactt
tcacacgtggccccggggataaggctggctggagcatggtacactggggttggagttaac
gattgcacacgagctgcaaggttgacagcccactcaatcctttcaggtaaacgtgaagag
acggggttagaaaaatatcttgatgaaaatgtagcaggttacgaattgcctcttgggagc
tcgggctaa

DBGET integrated database retrieval system