KEGG   Coccidioides posadasii: CPC735_052650Help
Entry
CPC735_052650     CDS       T01332                                 

Definition
(RefSeq) protoporphyrinogen oxidase family protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
cpw  Coccidioides posadasii
Pathway
cpw00860  Porphyrin and chlorophyll metabolism
cpw01100  Metabolic pathways
cpw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CPC735_052650
Enzymes [BR:cpw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     CPC735_052650
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     CPC735_052650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox Thi4 Pyr_redox_2 NAD_binding_9 MCRA NAD_Gly3P_dh_N FAD_binding_2 FAD_oxidored HI0933_like K_oxygenase Shikimate_DH ApbA Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 9691510
NCBI-ProteinID: XP_003066040
UniProt: C5PH92
Position
Unknown
AA seq 582 aa AA seqDB search
MRSRCSSAHAVEELWTLAQAHRFSTRPRVVFSKHLRNRTRLNFSSTASNDTRNVAVIGGG
ITGLATAYHLAKDQSTKVTIWERSDRLGGWLDSERINVNIGGDVLFDYGPRTLRATASAF
STLELINEFGLEKQILRTGIHDAASRNRYIYYPDHLVRLPGPQPGAGLLVNLISNAIGVF
TEPALKSLPWALATEPLRPSRPKDLDDESVGDFVARRLGKDVADNIVSAVFHGIYAGDIY
KLSVKTILPRIWEYEISRRGIFGSLLNTKRTLHLPYDLYHEGKIIREEKGKEFLSKIGSY
ISGASVFALKGGMGQLVEALDTSLSNSPNVEIITGSSVDHIERRDTQWRIGAKDYNCVVS
TTSSAELRRQIAPILTNTGALVALESHNYAVNVMVVNFFFRSPNLVPVHGFGYLIPRSIP
LEQNPERALGVVFMSDSNVGQDTARGTKLTVMIGGHWWDGWRDGDFPDERSGIQMAKAVL
KRHLHINEEPIVAKAKLLKNAIPQYTVGHTARMKDLHFSLSHVAPGIRLAGAWYTGVGVN
DCTRAARLTAHSILSGKREETGLEKYLDENVAGYELPLGSSG
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcgcgatgttcgtccgcccatgcagttgaagagctatggacgcttgctcaagca
cacaggttttccaccaggccacgcgttgtattttcgaagcacttaaggaaccgaactcga
cttaatttctcatccacagctagcaatgacacaagaaatgtcgcagtaatcggtggcggc
attaccggccttgcaactgcttatcatcttgcaaaagaccaatcgactaaagtcacgatc
tgggagcgctcagatcgtctaggcggatggctggattctgagaggatcaacgtcaatatt
ggtggagatgtgcttttcgactatggacctcgcaccctccgtgcgacggcgagtgcgttt
tccactctcgaactgataaacgagttcggtctcgaaaagcagatccttcgtacgggcatt
catgacgctgcttcgcgcaaccgctacatttattacccagaccaccttgtccgcctacca
ggaccgcaacccggggccggcctgctcgtaaacctcatctccaatgctataggcgtattt
acggaaccggcgttgaagagcttaccatgggcgctggcgaccgagcccttgagaccctct
cgtcccaaagatcttgatgacgaatccgtgggagatttcgtagctaggagattggggaaa
gacgttgctgataatatagtttccgctgtctttcatggtatctatgctggtgatatatat
aagctcagtgtcaagacaatattaccccgtatttgggagtatgaaatatcgaggcgtggc
atctttgggtcgttgctcaacactaagaggacgctacatctcccgtacgatctttaccac
gagggaaaaataatcagggaagagaaaggaaaagaatttcttagtaaaatcggctcctac
atctctggtgctagtgtctttgccttgaaaggggggatgggacagctggtcgaagccttg
gatacgtcgctttccaactctccaaacgttgagataattacgggttcaagtgtcgatcac
atagagcggcgtgatactcaatggcggattggagcgaaggactacaattgtgtcgtctcg
actacttcgtctgctgagctccgccgacaaatagctcccattctgacaaatactggagcc
ctcgtggcgcttgaaagtcataattacgccgttaacgtaatggttgtcaatttcttcttc
aggtctccaaacctggtgcccgtccacggtttcggttacctgattcctcgttctataccc
ctggaacaaaaccctgaacgtgccttgggtgttgtgtttatgtccgattccaacgtcggt
caagacacagcacggggtactaagctcaccgttatgataggaggccactggtgggacggg
tggagagacggggattttcccgatgagcggtcgggaattcaaatggccaaagcagtgctg
aagcgtcatctacatattaatgaggagccgattgttgccaaggcgaaactgctgaaaaat
gcaattccgcagtatacggttggacatactgctcggatgaaggacctgcatttttcactt
tcacacgtggccccggggataaggctggctggagcatggtacactggggttggagttaac
gattgcacacgagctgcaaggttgacagcccactcaatcctttcaggtaaacgtgaagag
acggggttagaaaaatatcttgatgaaaatgtagcaggttacgaattgcctcttgggagc
tcgggctaa

DBGET integrated database retrieval system