KEGG   Coccidioides posadasii: CPC735_053940Help
Entry
CPC735_053940     CDS       T01332                                 

Definition
Glutamate 5-kinase, putative (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cpw  Coccidioides posadasii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CPC735_053940
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CPC735_053940
Enzymes [BR:cpw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CPC735_053940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 444 aa AA seqDB search
MKGTSKALTIVIKLGTSSIVDEHTREPILSILTLIVEMATKLHKDGHRVIIVSSGAVGVG
LRKMDIEQRPKHLPCIQALAAVGQCQLMGIWDSLFAHLRQPIAQILLTRNDIADRTQYIN
AQNTFDELLKMGVIPIVNENDTLAVSEIKFGDNDTLSAITAAMVQADYLFLLTDVDGLYT
SNPRTNPDAEVIEVVDDISSLEADVSTAGSSLGTGGMSTKIVAARLATSAGVTTVITRSS
RPGNISEIIDYLESSKRSLALIEGEPMAQPPLYTPPLHTRFLPSTTPMQSRSFWILHGIT
PHGTIYIDHGAYCAILNNASLLPAGVVAVEGHFSQQEAVRVVVVERRSASALNGDFPLNG
EEPKEAGRALVNYGSAEIARIKGLRSTQIRTVLGYADSEYIALRENISFFHMSDRPSRPG
TPGLDEFMVRSGAQSPVIDKVVAA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaagggaacctcgaaggcattgaccattgtgataaagctcgggacgagttcaattgtg
gatgagcatacccgtgagccgattctttcgatccttactctgatcgtggagatggcgacc
aaacttcataaggatggccatcgagtcattatcgtctcgtctggagcggtcggcgttggg
ctacgcaaaatggacattgagcagagacccaaacatttgccctgtattcaggctttggct
gctgttggacagtgccagttgatgggtatatgggatagtcttttcgctcatcttcgccag
cccattgcccaaatattgttgacaagaaacgatattgcggataggacccaatatattaat
gctcaaaatacctttgatgaattgctaaaaatgggcgtgattcctattgtgaacgagaat
gatacccttgctgtttcggaaataaaatttggagataacgataccctttctgccattaca
gctgcgatggtccaagcggattacttattccttttgactgatgtcgatggcctatacact
tctaacccgcgaaccaaccccgatgccgaggttatcgaagtggttgatgatatctcgtct
cttgaagctgacgtttcgacagccggatcctccttaggcacggggggaatgagcaccaaa
attgtggcagcccgactagctacaagtgcaggtgtcacaaccgtcattacacgcagttct
cggcctggaaacatttcggagattatagattacctcgaaagctccaagcgctcgctggcc
cttatcgaaggagagccgatggctcagcctcctctatatacccctccgttacacacccgt
ttcctcccttcgaccactccgatgcaatccagatcgttctggattctccatggaatcaca
cctcatggcacaatatatatcgaccatggtgcttactgcgctattttaaacaacgcaagc
cttcttccggccggcgtcgtggcagtcgaggggcacttctcccaacaggaagcggtgcgg
gtcgtagtcgtcgagcggcgctccgcatcggctctcaatggggatttccctctgaacggc
gaggagccaaaggaagccggacgagcgctcgtaaattacggcagtgcggagatcgcccgt
atcaaggggttaagaagtacacaaatacggacagttttgggctacgcagatagcgagtac
attgcgttgcgcgagaatatttcctttttccacatgtcagatcgacctagtcggcccggt
acgcccggtttggatgagttcatggttcgaagcggcgcgcagtctcctgtgatcgataag
gtagtggcagcctag

DBGET integrated database retrieval system