KEGG   Coccidioides posadasii: CPC735_054770Help
Entry
CPC735_054770     CDS       T01332                                 

Definition
protein bimA, putative
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
cpw  Coccidioides posadasii
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CPC735_054770
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    CPC735_054770
   04113 Meiosis - yeast
    CPC735_054770
Protein phosphatases and associated proteins [BR:cpw01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CPC735_054770
Ubiquitin system [BR:cpw04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     CPC735_054770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 790 aa AA seqDB search
MPPSAPHISNQLRQLVYYHLDNNLIRNALFVAGRLHAFEPRSSEAAYLLSLCHLLAGQSK
AAWEVSRNSGSRGTHLGCSYVYAQACLDLGKYIEGITALERSRPHWILRNNWNKHSESRR
QHLPDAAAVQCLQGRLWKAHKDIHKAVDCYVEALKLNPFLWDAFLGLCEAGASVRIPNIY
KMTPEMIAVLTASPSAENLASFDKGLPATGPLQVQPHSNNNVDPFISLNPRAETTGSSAL
WEKLNGNSMNVIPGTEGMETPIAQSDSDDFRANGGGGMGSESFGEPPLAPARKQRSMQVL
GLDLDPPPKMKSTVSRMKTRSCAEAEEGVSTREAPVPLVSERKRTVSGHIAPSSSTQLTE
PGAPQRRSVRLFNQIRPSASKISASASGLGTKEGRDIKKVKSTGVKTRSASGSATTRVAS
GSRKAVTEPMDIDRKESAHGNQSKASPPDKSKEIEAIGWILELFSKLATGFNMLSNYRCQ
EAIQIFSSLPQSQRETPWVLSQLGRAYYEQAQYGEAEKYFIRVRTIAPHSLEDMEVYSTV
LWHLKNAVELAYLAHELMEVDRLSPQAWCAIGNSFSLEGDHDQALKCFQRATQVDPRFAY
AFTLQGHEYLSNEEHDKAMDAYRHAIGADNRHYNAWYGLGKVYEKMGKFKFAEQHYRTAS
NINPTNVVLICCIGLVLERMGNQKGALLQYARGCTLSPQAVVPRLRKARTLLKLHEVKHA
HAELKILKDIAPDEPNVHYLLGKFYKMMHDKSNAIKHFTTALNLDPKAAQFIKDAMESLD
SPDDFDDDMS
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgcccccttcagcgccccatatctccaaccagctacggcaattggtctactatcacctt
gacaacaaccttattcgaaacgccctttttgtcgctggccgcctgcatgcattcgaaccg
agatcttcggaagcagcctacttactatccctttgtcaccttctagccggccagtcaaaa
gcagcgtgggaagtcagcaggaattctggctccagaggtacacatcttggatgctcatac
gtatacgcccaagcatgccttgaccttggaaagtatatcgaaggaatcacagctttggag
cggagcaggccacactggattttaaggaataactggaataaacacagtgaaagtcgtcgc
cagcatctacccgacgccgccgcggttcagtgtctccagggacggctgtggaaagctcac
aaagatatacataaggctgtagattgctacgtcgaagccctgaaattaaatccttttctt
tgggacgcttttcttggcctctgcgaagcaggagcaagcgttcgaattcccaatatttat
aaaatgacgccggagatgatagccgttttaacggcttctccatcagctgagaatcttgcg
tcttttgataaaggtttaccagcaactggtccgctgcaggtacagccgcattcgaataac
aacgttgatccgtttatttctctcaatcctcgggcggaaacaaccggaagctctgcgctg
tgggaaaagttgaacggaaactccatgaatgtcatcccaggcaccgaaggcatggaaacc
cctattgctcaaagcgattctgacgatttccgagccaatgggggtgggggaatgggatct
gaatcttttggggaaccgccacttgcgccggcacggaagcagcggtccatgcaggtcctg
ggcctcgaccttgatccacctcccaagatgaaatccactgtctcgagaatgaaaactcgc
tcttgtgctgaagccgaagaaggggtttctactcgagaagccccggtacccctcgtttcc
gagcgtaagagaacagtatctggacacatcgcaccgagttcatctacgcaattaaccgag
cccggggccccgcagcgaaggagtgtccgattattcaaccaaattcgcccaagtgcaagt
aagatttctgcttcggcgagtggtctcggaacaaaggaaggccgcgatattaaaaaggtc
aagtctaccggtgtaaaaactcgaagtgcttccggttcagctacgacgagagttgctagc
ggtagccgtaaagcggtcacagagcctatggatatcgacaggaaggaaagcgcccatggt
aatcagagtaaggcttcgcctcccgacaaatcaaaagagattgaggctataggctggatt
ctagaactattctcgaagcttgctactggtttcaacatgttgtcgaattatcgatgccag
gaagctatccaaatttttagttccttacctcaaagccagagagaaacgccgtgggtcctg
tcacaacttggacgtgcatattatgagcaagcgcaatacggcgaagcggagaaatacttc
attcgagttcggaccattgcaccacacagtttggaggatatggaggtctattcaacggtc
ctctggcatctcaaaaatgccgttgaactagcatacctcgcgcatgagctcatggaagtt
gatcggctatcgccacaggcatggtgcgcgataggaaattcgttttctctggaaggtgac
cacgaccaagccctgaagtgttttcagcgtgccacgcaggttgacccacggtttgcgtac
gcctttactttgcaaggacatgagtatctttccaatgaagagcacgacaaagcgatggat
gcttatcggcatgcgattggcgctgataacaggcattataatgcctggtatggattgggc
aaggtctatgaaaagatgggcaaattcaagtttgcagagcagcattatcgaacggcgtcg
aacatcaatccaactaatgtcgtgctaatctgctgtattggcctagtgttggaacggatg
ggaaaccagaagggcgcgttgctgcagtatgctcgaggctgcactctgtcaccacaggcg
gttgttccacggttgcgcaaggctcggactctgttgaaacttcatgaagtcaaacacgct
cacgcagaattaaaaatcttgaaggatattgcacccgatgagcctaatgtccattatctt
ctcggcaagttctacaaaatgatgcatgataaaagcaatgcgattaagcatttcacaact
gccttgaacttggatccaaaggccgcccagtttatcaaagatgccatggagtcgttggat
agccccgatgatttcgatgatgatatgagctag

DBGET integrated database retrieval system