KEGG   Coccidioides posadasii: CPC735_054820Help
Entry
CPC735_054820     CDS       T01332                                 

Definition
(RefSeq) acetyl-CoA carboxylase, putative (EC:6.4.1.2)
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14]
Organism
cpw  Coccidioides posadasii
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CPC735_054820
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CPC735_054820
   00640 Propanoate metabolism
    CPC735_054820
  Lipid metabolism
   00061 Fatty acid biosynthesis
    CPC735_054820
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    CPC735_054820
Enzymes [BR:cpw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     CPC735_054820
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     CPC735_054820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2287 aa AA seqDB search
MPEITNGHGSSYAAKHNIPSHFIGGNSLEVAPPGAVKDFVAQHDGHSVITSVLIANNGIA
AVKEIRSVRKWAYDTFGDERAIQFTVMATPEDLQANADYIRMADRYVEVPGGTNNNNFAN
VELIVDVAERTGVHAVWAGWGHASENPKLPESLAASPKKIIFIGPPGSAMRSLGDKISST
IVAQHAGVPCIPWSGSGVDEVTIDDNGIVTVEDDIYDRGCTHSPQEGLEKARAIGFPVMV
KASEGGGGKGIRKVEREDDFINLYNAAASEIPGSPIFIMKLAGNARHLEVQLLADQYGNN
ISLFGRDCSVQRRHQKIIEEAPVTIAKSSTFQAMERAAVRLGKLVGYVSTGTVEYLYSHA
DDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPLHRIRDIRLLYGVDVNTSSE
IDFDFSNEESLKAQRRPQPKGHTTACRITSEDPGEGFKPSSGTMHELNFRSSSNVWGYFS
VGTSGGIHNFSDSQFGHIFAYGENRSASRKHMVMALKELSIRGDFRTTVEYLIKLLETPA
FEDNTITTGWLDELITKKLTAERPDSVIAVICGAVTKAHVASEACIAEYKKGLEKGQVPS
KDVLKTVFTIDFIYEDVRYKFTATRASLDSYHLFINGSKCLVGVRALADGGLLVLLNGRS
HNVYWKDEAAATRLSVDGKTCLLEQENDPTQLRTPSPGKLVHYTVENGAHVKSGEVFAGI
EVMKLYMPLVAQEDGVVQFIKQPGATLQAGDILGILTLDDPSKVKHAQPFLGQMPDMGLP
QVVGSKPPQRFRLLHNILQDILLGFDNQVIMSGTLAELVEVLRDPDLPYGEWNAHVSALH
SRMPQKLDAQLTQVIEKSKARKADFPAAQLMKTFTRFLDENVAPADVEILKATLAPLVQV
IQDYTEGLRAHEYNVIAALLEQYWNVEHLFAQRNIRDEDAILKLRDEHKDDIMNVIQTVI
SHTKVGGKNNLVLAILETYRPNKPTTPNVGKYLKPILKKLAELESRPCSKVALKARELLI
QCALPSLEERMAQMEHILRSSVVQSKYGETGWDHREPDLDVLKEVVDSKYTVFDVLPLFF
GHQDQWVSLAALEVYVRRAYRAYDLQGVQYHNDQEIPFFISWDFVLRKVPQAEFGMNTAL
SNPSVPSTPTTENNPFKKISSISDMSYLVNKGANEPVRKGVLIPAQYFDEIEEVLSRALE
VFPRADRVQRPGSNNALELAAKRKPQPRPENDELVGVCNIAIRDMEGLDDKEVAARLSKI
VSDFKDDLQSRCVRRITFVCGHGDGTYPGYFTFRGPAYDEDESIRHSEPALAFQLELGRL
SKFNISPVFTENRNIHVYEAIGKGPAKEATADKRYFTRAVVRPGRLRDDIPTAEYLISEA
DNLMNDILDALEIIGNNNSDLNHIFINFTPVFQLQPSDVEQALAGFLERFGRRLWRLRVT
GAEIRILCTDPTTGMAYPLRVVITNTSGYIIQVEMYVERKSEKGEWVFHSIGGTTKVGSM
HLRPVTTPYPTKEWLQPKRYKAHLMGTQYVYDFPELFRQAFQNAWIDAIASQPSLAEKRP
PQGGCIDYSELVLDDSDNLVEVSREPGTNTHGMVGWIVTARTPEYPHGRRFIVVANDITY
QIGSFGPLEDKFFHKCTELARKLGVPRIYLSANSGARIGMAEELMPLFSVAWNDPKKPEA
GFKYLYLTPEVKKKLDERKSKDVITELVHEDGEDRYKITTIIGAKDGLGVECLRGSGLIA
GATSRAYEDIFTITLVTCRSVGIGAYLVRLGNRAIQVEGQPIILTGAPAINKLLGREVYT
SNLQLGGTQIMYKNGVSHMTANDDFEGVQKIVQWMSFIPDRKGSPIPIRPSSDPWDRDIT
YYPPKQTYDVRWLIGGKEDEEGYLSGLFDKGTFQETLGGWARTVVVGRARLGGIPIGVIA
VETRSVDNITPADPANPDSMEMVTTEAGGVWYPNSAFKTAQALKDFNFGEQLPVMILANW
RGFSGGQRDMYNEVLKYGSYIVDALVKYEQPIFVYIPPFGELRGGSWVVIDPTINPDQME
MYADEESRGGVLEPEGIVGIKYRREKQLETMARLDPIYGELRRSFQDASLSAEQLSEIKN
KMTERENQLLPVYLQIALQFADLHDRAGRMEAKGTIRKPLQWKNARRFFYWRLRRRLSEE
LILKRMASVSAESQVGSPESSRSPSPTSSPGPAKPTLREKNLLMLRSWTGLLDKDFEDED
RKVALWYEENKKVLYEKVESMKTNSVAMQVAQLLMGDKEGGLKGVQQVLSMLPLEEKESV
LKYLSSS
NT seq 6864 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagatcacgaacggtcatggcagctcatatgctgcaaagcataatatcccatca
catttcatcggcggtaacagcttagaggtagcgccaccgggggctgtcaaggactttgtt
gctcagcacgatggtcactccgtcattacctcagtcttgattgcaaacaacggcattgct
gccgttaaggagatcagatcggtccggaaatgggcctatgacacattcggtgatgaacgc
gcaattcaattcacagtgatggcaaccccggaggaccttcaggcgaatgcggactatatc
cgcatggccgatagatatgtggaagttcccggaggtaccaataacaacaattttgctaat
gtcgagctcattgtcgatgttgcggagagaacaggagttcatgcagtctgggccggctgg
ggacatgcttcggaaaatccaaaactgccagaatcgttagccgcctctcctaagaagatt
atcttcattggcccgccaggatcagccatgagatcccttggtgacaagatctcttctacc
atcgttgcacaacatgccggagtcccgtgcattccatggtccggttcgggagttgacgag
gttacgattgacgacaatggcattgttaccgtcgaagatgacatctacgatcgaggatgc
acacattctcctcaggaaggcttagaaaaagctagagctatcggctttccagtgatggtt
aaagcgtccgaaggtggcggcggaaaaggtattcgcaaagtggaaagggaggatgatttc
atcaatctctacaacgccgctgccagtgaaattcccggttcgcccatttttatcatgaaa
cttgctgggaatgccaggcatttagaggtccaattgctggccgatcagtatggaaataat
atttcgcttttcggcagagactgctccgtccagcgccgtcaccaaaagatcatcgaagag
gcacctgtcacgattgcgaaatcttctactttccaggcgatggaacgcgccgccgtgaga
ctcggcaaactcgtcggatatgtctcgactggtactgtggaatacttgtattcccatgcc
gatgacaagttctacttcctagagctaaaccctcgtctccaagtcgaacatccaaccact
gagatggtcactggtgttaatttgccagctgctcagcttcaaattgccatgggtattccc
ttacaccgtatcagagatattcgccttctctatggtgtcgatgtcaataccagttccgaa
atcgattttgatttctcgaatgaggaaagtctcaaagctcagcggcgtcctcagccaaag
ggacacacaacggcctgccgtattacttctgaggatcctggcgaaggctttaagccgtcc
agtggcacgatgcacgagctcaacttccgaagcagctctaacgtatggggttatttttcc
gttggaacttctggtggaattcataacttctccgattcccagttcggccacatttttgcc
tatggagaaaatcgatccgcgtcaaggaaacatatggttatggccttgaaggaactgagc
attcgtggtgactttagaacgaccgtcgagtatttaatcaaactcctggaaacgcctgcc
tttgaagataacacaattactactggctggcttgatgaacttatcactaagaagctaaca
gctgagcgcccggactccgtgattgctgttatttgtggagctgtgaccaaagcccatgtc
gcgagtgaagcctgcattgcagaatacaaaaagggtctcgaaaagggtcaagttccttca
aaagatgtcctaaagactgtattcacgatcgattttatctacgaagacgtccgatacaag
tttaccgcaactagagcaagcttagacagctatcatctatttatcaacggatcaaaatgc
ttggttggcgtccgtgctcttgctgacgggggtttgcttgttttgttgaatgggcgaagt
cacaacgtgtactggaaagacgaagctgctgctacacgcttaagtgtcgatggcaaaact
tgtctcctggaacaagaaaatgatcccacacagcttagaacgcccagcccaggtaagctg
gtgcattatacggtagaaaatggggcgcatgtcaaatccggtgaagtctttgctggaatc
gaggttatgaagttgtacatgcccttggttgcgcaagaagatggcgttgtccaattcatc
aaacaaccaggtgctaccttgcaggctggtgatattctcggaatcctcacgttggatgac
ccatccaaggtgaaacatgcacagccattcctcgggcagatgccagatatgggtcttcct
caagtcgtgggcagcaaacctccgcagcgattccggcttcttcacaatatcttgcaagac
atccttctcggcttcgataaccaggtgatcatgtctggtacgcttgcagagttggtcgag
gtgctgagagacccggatttgccatatggtgaatggaacgcgcatgtttccgctcttcat
tcccggatgccgcaaaaacttgacgcgcagcttactcaggttatcgaaaagtccaaggcc
cgaaaggccgacttccctgctgcccagttgatgaagaccttcactcgcttcttggatgaa
aacgtagctcctgccgatgttgaaatcctcaaggctacgcttgctcctctggtccaagta
atccaggactacactgaaggcttgagagcccatgagtacaatgtgatcgctgcccttttg
gagcaatattggaatgtggaacacctcttcgcccagagaaacatccgtgatgaagacgcg
atcctgaagcttcgagatgaacacaaggatgacattatgaatgtaattcaaaccgttatc
tcccacaccaaagttggcggaaagaataacttggtactggcaattcttgagacataccgg
ccaaacaaaccgactacgccaaatgtcgggaaatacttgaaaccgatattgaaaaaattg
gcggaacttgaatcaaggccttgttccaaggttgcactcaaagcacgcgaacttctcatt
caatgtgctctaccgtcgttggaagagcgtatggctcagatggagcacatcctacgatct
tcggtcgttcagtcgaagtacggagaaacaggatgggaccacagggaaccagatctcgat
gtccttaaggaagttgtcgactcaaagtataccgtttttgatgtccttcctctgttcttt
ggccaccaggaccagtgggtatcgttggctgctttggaagtctacgttcgtcgggcttac
cgagcttacgacctccaaggcgttcaatatcataatgaccaggagattccattcttcatt
tcttgggatttcgttctgcgaaaggtacctcaggcagagttcgggatgaataccgcactt
tcaaacccctctgttccgagcaccccaacgacagaaaacaatccgtttaagaaaatcagt
tccataagcgatatgtcgtatttggtcaataagggtgcaaatgagccggtgcgaaaaggt
gtgctcattcctgcccagtacttcgatgagatcgaagaggtactctctcgagctctagag
gtattccctcgtgccgaccgtgtccagaggccgggctccaacaacgccctcgagctagct
gccaagagaaaacctcagccacgccccgaaaatgacgaactggttggagtttgtaacatc
gctattcgcgacatggaaggactagacgacaaagaagtcgctgcccgtctcagcaagatt
gtgtctgacttcaaggatgatctgcagtctcgttgcgtccgcagaataacattcgtctgt
gggcatggcgacggaacctaccccggatacttcaccttcaggggtcctgcatacgacgaa
gatgaaagcattcgccacagcgaacctgcattggctttccagctagaactcggccgactg
tccaaattcaacatcagtcctgtgttcaccgaaaacaggaatatccatgtttatgaagca
atcggtaaaggacctgccaaagaggccaccgctgacaagcgttacttcacccgtgctgtt
gtacgaccaggccggttacgcgatgatatccccactgctgagtacctgatctccgaagcc
gataacctcatgaacgacattttggatgccctggagatcattgggaacaataactccgac
ttgaaccacattttcattaacttcacccctgtcttccaactgcagccatcggatgtggaa
caagctcttgcaggtttcttggagcgcttcggccggcgactttggcgcctgcgcgtaacc
ggagcagaaattcgaattctctgtactgaccctaccactggcatggcatatcctctccgt
gtagtgattacgaatacatccggctatatcatccaagttgagatgtacgtggaaagaaaa
tcggagaagggagagtgggtgtttcacagcattggtggtaccaccaaggttggatctatg
caccttcggccggtcacgacgccataccccacaaaagagtggcttcagcctaaacgttac
aaagctcatctgatgggaacgcaatacgtgtatgatttcccagaactgttcagacaagct
ttccagaatgcctggatcgacgctatagccagccagcccagccttgctgaaaaacgacct
ccccagggtggttgtattgattacagtgagcttgtcctcgacgattctgataacttggtt
gaagtgtcacgagagcccggaaccaatacccatggtatggttgggtggatcgtcacagcc
agaactccggaatatcctcatggcaggcgcttcatcgttgttgccaacgatatcacctat
caaattggctcgttcggaccattggaagataaattcttccacaaatgtactgaactcgct
aggaaattaggtgttccgcgaatttacctgtctgccaactcgggtgctcgtatcggcatg
gcggaagaattgatgccactcttctctgttgcttggaacgatcccaagaagccggaggct
ggcttcaagtatctctacctgactccagaagttaagaagaagctggatgagcgaaagtcg
aaagatgtcatcaccgaacttgtccatgaagacggtgaagatagatacaagattacaact
atcatcggcgccaaggatgggttgggtgtcgagtgcctgagaggttctggtcttatcgcc
ggagctacatcgagagcctacgaagatattttcacgatcactctcgtgacttgccgctcc
gttggtatcggtgcttatctcgttcgtctcggtaaccgtgctatccaggttgaaggacaa
cccattattctaacaggtgctcctgccatcaataaacttcttggtcgagaagtctatacg
tccaatctgcaacttggtgggacgcaaatcatgtacaagaatggcgtttctcatatgacc
gccaacgacgattttgaaggtgtccagaagattgtccagtggatgtccttcattcctgat
cgcaagggctcgccaattccaattcgaccaagctcggatccatgggatcgtgacattacc
tactacccacctaaacaaacgtatgatgtgcgatggctcattggtggtaaggaggacgaa
gaaggctatctctccggtctcttcgacaagggcaccttccaagaaactctcggaggctgg
gctaggacagtggtggtcggccgtgcgagacttggtggaattccaattggtgtaattgct
gtcgaaactcgttccgtggataacattactccggcagatcctgctaatccggattctatg
gaaatggtcacaactgaagctggcggcgtgtggtaccccaactccgctttcaagactgct
caagctttgaaggactttaacttcggtgaacaacttccagtcatgatcctggccaactgg
cgtggtttctctggtggccagcgcgacatgtacaacgaggtcttgaaatacggttcctac
attgtcgatgctcttgtaaagtatgagcagcctatcttcgtttatatcccaccatttggc
gaacttcgtggtggctcgtgggtcgttatcgatcctaccatcaaccctgatcaaatggag
atgtacgccgatgaagaatcgcgtggtggtgtcctcgaacctgagggtatcgtcggcatc
aagtatcgtcgcgagaaacagctagaaaccatggctcgtctcgacccgatttatggagaa
cttaggcggtcgtttcaggacgcgtcactgagtgccgaacaattatccgaaatcaagaac
aagatgactgagcgtgaaaaccaactccttccggtttatcttcaaattgctctccagttt
gccgatctacacgatcgtgccggtcgcatggaggcgaagggaaccatccgcaaaccgctt
cagtggaagaacgcgcgacgatttttctattggcgtctccgtcgccgtctcagcgaggaa
ctcattctcaagcgtatggcatctgtcagcgctgaatcccaagttggaagcccagaatcg
tcgagaagcccgtctcctacctcctcacccgggccagcgaagccaactctgcgtgagaag
aatcttctcatgctcaggtcttggactggcttactagacaaggacttcgaggatgaggat
cgcaaggttgctctttggtacgaggagaacaagaaggtcttatacgagaaggtcgaatcc
atgaagaccaatagtgttgcaatgcaagttgcacagttattgatgggcgacaaggagggt
ggtctgaagggagtgcagcaggtgttgagcatgctgccactcgaggagaaagaatccgtt
ttgaaatacttgagcagctcttaa

DBGET integrated database retrieval system