KEGG   Coccidioides posadasii: CPC735_055000Help
Entry
CPC735_055000     CDS       T01332                                 

Definition
dihydrofolate reductase family protein (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cpw  Coccidioides posadasii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CPC735_055000
   00670 One carbon pool by folate
    CPC735_055000
Enzymes [BR:cpw01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CPC735_055000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 310 aa AA seqDB search
MEAIIAGFTMSPHCPSAFANSAKLPPLTLVVATTPVTSHTNPSISRLGIGNCGTLPWPRI
KSDMSFFARITTRPPAAAQPQLHTPNALNAVIMGRKTYDSLPSRFRPLPKRLNVIITRDE
SGMVCERAAAEWKAARKREWEKAQEKKDEFRTESKSCSSTEKNDSIEELEKETPDVLVSN
GIGSALLALRDSFNPFSQNGRRSLGNVLVIGGAEIYASSLKLDPTGLGCKMRIVMTDVRR
PTSEAEKNDPSRSSNGFECDTFFPIDNLDGNDEWRRASAGEVSEWVGEAVPEGWVWDQDI
ALRFLGYERR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggaggccatcatcgcgggctttaccatgtctccccattgcccctcagcattcgcaaac
tccgcaaaactaccgccgcttacgcttgtcgtcgcaacaacaccagtcacctcccataca
aaccccagtatttctcgccttggaatcgggaattgtggaacacttccatggcctcgcata
aagtctgacatgagcttttttgcacgtataacgacgcgcccgcctgccgcagcccaaccc
cagctccatacccctaacgccctaaatgcggtgataatgggaaggaaaacatatgattcc
ctccctagcagatttcgaccacttccgaaacggttgaatgttattataacgcgcgacgag
tcgggaatggtatgcgagcgggcggcagcagagtggaaggctgcgagaaaaagagagtgg
gaaaaagcgcaggagaagaaagatgaatttaggacagagtccaagagctgttcgtctacg
gagaaaaatgattcaatcgaggaattggagaaggaaacccctgatgtccttgtgtctaat
ggtatcggatctgctcttctcgccctacgagatagcttcaaccctttttcccagaatggt
cgacgaagtctcgggaatgtccttgtgattggcggcgccgagatatacgcatcctcttta
aaactagatcccactggcctaggttgcaaaatgaggattgtcatgacagatgtccgtcgg
cctacttcggaagccgagaaaaacgatccatcacgatccagcaatggctttgaatgcgat
actttctttccaattgataacttagatggaaacgatgagtggagacgggcttctgcgggc
gaagtatcagagtgggttggcgaagcggttccagaaggctgggtatgggatcaagacatt
gctcttcgcttcctcgggtatgagcgaaggtga

DBGET integrated database retrieval system