KEGG   Coccidioides posadasii: CPC735_055150Help
Entry
CPC735_055150     CDS       T01332                                 

Definition
Agmatinase, putative (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cpw  Coccidioides posadasii
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CPC735_055150
Enzymes [BR:cpw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     CPC735_055150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 359 aa AA seqDB search
MGAGNVNLQWAFSGISTFARLKHVKCLLEPDELYDIAIIGAPFDTAVTYRPGARFGPRAI
RAASSRQVPGLAYNTRAGINPYLSWARILDCGDIPVVPFDNAIAESQMYEAFLELGNRPT
PKNGRPKLITLGGDHSIALPALRALYKIYNKPITVVHFDAHLDTWNTLRYSEVWTSEQSR
FTHGSFFHTASLEGLISNTSSVHAGLRTRLTGTDDGDYTNPGPEQGFMRIHADDIDDIGV
KGVIDAIISRVGLLPDEPVYLSLDIDVLDPSIAPGTGTPEPGGWTTRELIRILRGIEKLN
LVGADIVEVSPTYDGHGEGTALAAAQMVYELLASMVKLELKEEAGGWYGKKSQKSRDEL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgggggcaggaaatgtaaacttacagtgggcgttctcgggcatttccacctttgcgcgc
ctcaaacatgttaaatgccttctggagccagacgaactctatgacattgcaatcatcgga
gcgccatttgacacagcggtcacatacagacccggtgcgcgatttggccctcgggccatt
cgcgctgccagcagtcgccaagtgccgggattggcatacaacacccgcgcagggataaac
ccctatctcagctgggcccgaatcctggactgtggtgacatccccgtcgttccattcgac
aatgctattgccgaatcgcaaatgtacgaagccttcctcgagcttggtaaccgaccaacg
ccaaagaatggcagacccaaactcatcaccttaggaggtgatcacagcatcgcgcttcca
gcgcttcgcgccttgtacaagatttataacaagccgattacggtggtgcatttcgacgcc
cacctcgacacatggaatacactccggtactcggaggtgtggacttctgagcaatcccgc
ttcactcacggcagtttttttcacactgctagtcttgaagggcttatttccaatactagt
tccgtccacgcgggactacgaactcgtctgacgggtactgacgatggcgactacaccaat
ccgggtccggaacaaggcttcatgcgaattcacgctgacgacattgatgatatcggcgta
aagggggtgattgacgcaatcatctctcgtgtcggtctcttgcccgacgagcctgtatat
ttgagcctcgatattgacgtcctcgaccccagcatcgcgccagggacagggacgcccgaa
ccggggggttggacgacgcgagaattgattagaatcctccgggggattgagaagctgaac
cttgttggagcagatatcgtggaagtatcacccacttacgacggacatggagaaggaaca
gctctcgcagcggctcaaatggtctatgagttactggccagcatggtaaagttggaactt
aaagaagaagccggtgggtggtatggcaagaagagtcagaaatctcgcgacgagctgtga

DBGET integrated database retrieval system