KEGG   Coccidioides posadasii: CPC735_055150Help
Entry
CPC735_055150     CDS       T01332                                 

Definition
Agmatinase, putative (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cpw  Coccidioides posadasii
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cpw00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 359 aa AA seqDB search
MGAGNVNLQWAFSGISTFARLKHVKCLLEPDELYDIAIIGAPFDTAVTYRPGARFGPRAI
RAASSRQVPGLAYNTRAGINPYLSWARILDCGDIPVVPFDNAIAESQMYEAFLELGNRPT
PKNGRPKLITLGGDHSIALPALRALYKIYNKPITVVHFDAHLDTWNTLRYSEVWTSEQSR
FTHGSFFHTASLEGLISNTSSVHAGLRTRLTGTDDGDYTNPGPEQGFMRIHADDIDDIGV
KGVIDAIISRVGLLPDEPVYLSLDIDVLDPSIAPGTGTPEPGGWTTRELIRILRGIEKLN
LVGADIVEVSPTYDGHGEGTALAAAQMVYELLASMVKLELKEEAGGWYGKKSQKSRDEL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgggggcaggaaatgtaaacttacagtgggcgttctcgggcatttccacctttgcgcgc
ctcaaacatgttaaatgccttctggagccagacgaactctatgacattgcaatcatcgga
gcgccatttgacacagcggtcacatacagacccggtgcgcgatttggccctcgggccatt
cgcgctgccagcagtcgccaagtgccgggattggcatacaacacccgcgcagggataaac
ccctatctcagctgggcccgaatcctggactgtggtgacatccccgtcgttccattcgac
aatgctattgccgaatcgcaaatgtacgaagccttcctcgagcttggtaaccgaccaacg
ccaaagaatggcagacccaaactcatcaccttaggaggtgatcacagcatcgcgcttcca
gcgcttcgcgccttgtacaagatttataacaagccgattacggtggtgcatttcgacgcc
cacctcgacacatggaatacactccggtactcggaggtgtggacttctgagcaatcccgc
ttcactcacggcagtttttttcacactgctagtcttgaagggcttatttccaatactagt
tccgtccacgcgggactacgaactcgtctgacgggtactgacgatggcgactacaccaat
ccgggtccggaacaaggcttcatgcgaattcacgctgacgacattgatgatatcggcgta
aagggggtgattgacgcaatcatctctcgtgtcggtctcttgcccgacgagcctgtatat
ttgagcctcgatattgacgtcctcgaccccagcatcgcgccagggacagggacgcccgaa
ccggggggttggacgacgcgagaattgattagaatcctccgggggattgagaagctgaac
cttgttggagcagatatcgtggaagtatcacccacttacgacggacatggagaaggaaca
gctctcgcagcggctcaaatggtctatgagttactggccagcatggtaaagttggaactt
aaagaagaagccggtgggtggtatggcaagaagagtcagaaatctcgcgacgagctgtga

DBGET integrated database retrieval system