KEGG   Coccidioides posadasii: CPC735_055320Help
Entry
CPC735_055320     CDS       T01332                                 

Definition
Ubiquitin carboxyl-terminal hydrolase, putative (EC:3.4.19.12)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
cpw  Coccidioides posadasii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 247 aa AA seqDB search
MADNPDSTKAFVPLENNPEVMSHLVHQLGLSPALGFADVFSIDDPELIAFVPRPSHALLL
VFPISPAYESARIAEDSSKSEYTGSGPNEPVTWFKQTIRNACGLIGLLHAVSNGEPRKNV
TQGSDLETLLRDAEPLDPIKRADLLYESSALESAHADAARRGDTEAPQADANVDLHFVCF
VKGDDGRLWELDGRRKGPLDRGMLEEGEDMLSEKALKAGVRKFLESEAAGGAGDLRFSLV
SLGPAFD
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaatccagactctacaaaagcattcgtacccctcgaaaacaacccggaggtg
atgtcccacctcgtccaccaactcggtctctcccccgctctcggtttcgccgacgttttt
agcatcgacgacccagagcttatcgctttcgtcccccgtccctcccacgcgctactcctc
gtcttccccatctctcccgcctatgaatccgcgcgcatagccgaagactcctccaaatcc
gaatatactggctcgggccccaacgaacccgtgacgtggttcaaacaaactatccgcaac
gcatgcggtctcatcggcctcctgcatgcagtctccaacggcgaaccgcgaaaaaacgtc
acccagggatctgatcttgaaacgctcctgcgcgatgcagagccgttggatccgatcaag
agggcagatttgttgtatgagagctctgcgttggagagtgcgcatgcggatgctgcgagg
aggggggatacggaggccccacaggcggatgcgaatgtggatttacactttgtgtgtttt
gtaaaaggtgatgacggtcgattgtgggagttggatgggcggagaaaaggtccgttggat
aggggaatgttagaggagggagaggacatgttgagtgagaaggccttgaaagctggggtg
agaaagtttttggagtcggaggcggctggtggtgcgggtgatttgaggttcagtcttgtc
agtctgggaccggcatttgactaa

DBGET integrated database retrieval system