KEGG   Coccidioides posadasii: CPC735_055390Help
Entry
CPC735_055390     CDS       T01332                                 

Definition
(RefSeq) Mst1 protein, putative
  KO
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
cpw  Coccidioides posadasii
Brite
Enzymes [BR:cpw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CPC735_055390
Chromosome [BR:cpw03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    CPC735_055390
   HAT complexes
    TIP60 complex
     CPC735_055390
    NuA4 complex
     CPC735_055390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 519 aa AA seqDB search
MMGVRDPSQEAPSTPDPVERSLATLNTLRIGVKAFVEKDGDYRKAEILSMRQRKDGPAFY
VHYVDFNKRLDEWIPASRIDLTKEVEWPLPEKPEKKKVSGAAATKAQPKNSLKRARQASR
DVSSTPDLLAGKNLNISKQSKLSKASSGKENAEDGTPISIPQLPSEGVSAGGTPQLEVDS
EDVEMVDVAEAEAKAAIREEAEKAAEEAVRQEEIEKLRTGGSMTQNPTEIHRVRNLNRIQ
MGKYEIEPWYFSPYPTSFSDADMVYIDEFCLSYFDDQRAFERHRSKCTLVHPPGNEIYRD
DYVSFFEVDGRRQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTTRDAQGCHLVGYFS
KEKESAEGYNVACILTLPQYQRRGYGRLLIAFSYELSKREGKLGSPEKPLSDLGLLGYRQ
YWRETLVELLLEPGRDAISESELASLSGMTEKDVHETLVVLNLLKYNKGNWIIVLTDAII
EQRNKRLAKEQAKGSRKIDSSRLQWKPPVFTASSRTWNW
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgatgggcgtcagagatccctcgcaagaggcacccagcacgccagatcctgttgaaagg
agccttgccaccttgaatacgctaaggatcggtgttaaggcgtttgtcgaaaaggatggc
gactatcggaaagcagagatcctgtccatgagacagcggaaagatgggcccgccttctac
gtacattatgtcgacttcaacaagcgtcttgacgaatggatccctgcatcgcggattgac
ttaacgaaagaagtagaatggcctctgcccgagaaaccagagaagaagaaagttagcggc
gccgccgcaacaaaggctcagcccaagaattcactgaagcgggcaagacaagcaagtcga
gatgtatcttcaactccagatcttttagcaggaaagaatctcaatatcagtaaacaatcc
aagctgtccaaggccagtagtggcaaggaaaacgctgaagatggtactccgataagtatt
ccccagctgcccagcgaaggcgtctctgctggaggtactcctcaactggaggtggactct
gaagatgtggagatggttgatgttgccgaagctgaagccaaggcagcaatcagggaagag
gcagaaaaagccgccgaggaagctgttcggcaagaggaaatcgagaagctgaggacgggt
gggagtatgacacagaaccccacggaaatccatcgtgtgcgaaacctgaatcgaatccag
atgggaaaatatgaaatagagccgtggtacttttcaccatatccgacttccttcagcgac
gcggacatggtctacatcgatgaattctgtctcagttatttcgatgatcaacgtgctttt
gaaagacaccgatctaaatgtactctcgtccatccaccaggcaacgagatttatcgagat
gattatgtatctttttttgaagtggatggccgtcgacagcgaacatggtgtcgaaacttg
tgcttgctgagcaagttattcctggaccacaagaccctctactatgatgttgatcctttt
cttttctactgcatgactacacgcgatgcccagggctgccacctcgtcggatatttctcc
aaggagaaagaatcagccgagggctacaatgtggcatgtatccttacgcttccacagtat
caacgtcgtggatacggtcgactgctcattgcatttagttacgagcttagcaaacgggaa
ggcaaattaggctctcctgagaaaccactgagtgacctgggcctactcggctaccggcaa
tactggagagaaacgctagttgaacttctcctggaacccggtcgggatgccattagcgag
agtgaattggcaagtttaagtggcatgacagagaaggatgttcatgagaccttggtggta
ctaaacctcctcaaatacaataaaggaaactggataattgtcctcaccgatgcaatcatc
gagcaacgtaacaagcgtttagcaaaagaacaggccaagggatcccgaaaaatcgattcc
tcgcgtcttcagtggaaaccaccagttttcactgcctcaagccggacgtggaattggtag

DBGET integrated database retrieval system