KEGG   Coccidioides posadasii: CPC735_056630Help
Entry
CPC735_056630     CDS       T01332                                 

Definition
histone acetyltransferase GCN5, putative (EC:2.3.1.48)
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cpw  Coccidioides posadasii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 456 aa AA seqDB search
MAVLTRAGSKRKATDEPSTPDSKQKVKKARTESPGSEIKDDSASKPTLKIVPFAEKVRGA
GTYRVYVEILLMEPPVQPAVLEERRGDIEFRVVNNDGSRESFIILTGLKCIFQKQLPKMP
KDYIARLVYDRTHLSMAIVKHPLEVVGGITYRPFKGRRFAEIVFCAISSDQQVKGYGAHL
MSHLKDYVKATSEVMHFLTYADNYAIGYFKKQGFTKEISLDKSIWMGYIKDYEGGTIMQC
TMIPKIRYLESGRMLLKQKEAVHAKIRAFSKSHIIHAPPKEWRNGVCEIDPLSIPAIKES
GWSPDMDELARQPRHGPNYNQLLHLLNDMQNHSAAWPFAQPVNRDEVPDYYEVIKEPMDL
STMEEKHEKDLYPAPQDFIKDAMLIFDNCRRYNNENTPYAKSANKLEKFMWQQIKNIPEW
SLLILPVLLASGGGSLTQSGDCTQQNNTRVILCFLQ
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcggtactgacccgcgcaggtagcaagcgcaaagcgaccgacgagccgagcacgcca
gattcgaagcaaaaggtcaaaaaggcccggactgagtccccaggctctgagattaaggat
gactctgccagcaagcccacgctcaagatcgtcccattcgccgagaaggtaagaggagcg
ggaacataccgcgtttatgttgaaatattgctgatggaacctccggtgcagccggcagtg
ctggaagaacgacgcggtgatatagagttccgagtggttaacaacgacgggtccagagag
agcttcatcatcctcacaggtctcaagtgtatattccagaagcagttgccgaagatgccg
aaagactatattgcgcgactggtatacgataggacccatttatccatggctattgttaaa
cacccattggaggtagttggagggattacataccggcccttcaaagggcgaaggtttgca
gagattgtgttttgcgccatatcttccgaccaacaagtcaaaggttatggtgctcactta
atgtctcacctgaaggactacgtgaaagctacttctgaggtgatgcatttcctaacatac
gccgataattatgccatcggatacttcaagaagcaaggtttcacaaaagagatcagcttg
gacaagtcaatttggatgggttatatcaaggattacgaaggcggcaccatcatgcagtgc
accatgatcccaaagatccggtatctcgaatctggtcgcatgcttttaaagcaaaaggag
gctgttcacgccaaaatccgggcctttagcaagtcccatattatccacgctccacccaag
gagtggagaaacggggtctgcgagattgaccctctcagcattcctgccataaaagagtct
ggatggtctcctgatatggatgagctggcccgccagccacgacatggccctaattacaat
caacttttacatctactcaacgatatgcagaatcacagcgcagcttggcccttcgcacag
ccggtgaatcgggacgaagtccccgactactatgaagtgatcaaggagccgatggatctg
tcaaccatggaagagaaacatgaaaaggatctgtaccctgctccgcaagatttcattaag
gacgctatgttgattttcgataactgccggcgttataataacgagaatacaccctatgcc
aagagcgcgaacaaactggaaaaatttatgtggcagcagataaaaaatatcccagagtgg
tcgttgctgatcctgcctgtcctcctagcatctggcggagggtcattgacccagtctgga
gactgcactcagcagaataacacaagggttattttatgttttttgcagtga

DBGET integrated database retrieval system