KEGG   Coccidioides posadasii: CPC735_057100Help
Entry
CPC735_057100     CDS       T01332                                 

Definition
Cytochrome P450 family protein (EC:1.14.14.-)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
cpw  Coccidioides posadasii
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    CPC735_057100
  Amino acid metabolism
   00380 Tryptophan metabolism
    CPC735_057100
Enzymes [BR:cpw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     CPC735_057100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 495 aa AA seqDB search
MAGLLSSLSSATLVAVAAITVILFLALVYFFIPPASFPRNIPAIPFYYALLPLVKDGDQE
ALYHTYLEPLFEQHGAAKIFFGGRWNILVQRPSYIAEVFKYEDTYAKSGNQKKIPYSVLA
EYTGDNIISSHGENWKLYRSILQPPLQQDQDPGPIWRNSRLLISLLLEEQKTSPHGSVLL
PQLLQRFTLANLSEGLLGTSFQTLQQKDAALHKFQMMLKPLIFDPVFLNFPFLDHFNFPS
RQRARRLARQFANELCQTVQRGHQHAHTDKSTSNVGCSVIGAFEQGILSEKQFRNNMVSV
FLAGHENPQLLLVSMMFLLGEHQEIQERVREEVLSLGEDELPYSVLQSAPFLTSVIYETL
RMYPPISQLINRRTTKPVLLGGKIPLPAGTYIGYNAYATNRDKQSWGADADEFKPERWGR
TVDEINVTFRKANAKGAFISFHGGRRACLGQKFAMFEARIAMAEILRSLRWKIDPTWPRR
MTPVSWPSLPEKPAG
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggccgggctcctctcctctctgtcatccgcgaccctggtggcggttgcagcaattacc
gtcattctcttccttgctcttgtgtacttcttcattccccctgccagtttcccccggaat
atacccgctatacccttctactatgcgctgctgcctctggtcaaggacggcgaccaggaa
gcgctctaccacacctatctggagccgctcttcgagcaacacggagctgcaaagatcttc
tttggcggccggtggaacatccttgtgcagcgtccatcctacattgccgaggtattcaag
tacgaagacacatatgcaaagagcggaaaccagaagaagatcccgtacagtgtgctagca
gagtacactggcgacaacatcatcagctcccacggcgaaaattggaaactttacaggtcg
atccttcagccgccccttcaacaggatcaggaccccggtccgatttggcggaactcccga
cttctgatcagcctgctgttggaggagcagaagacatccccacatggctccgttctgctg
cctcagctcctccaacggtttaccctagccaacttgtcggaagggcttctggggacaagc
ttccagactttacaacaaaaggatgcggctctccacaaatttcagatgatgctcaagcct
ctgattttcgatcctgtctttttgaattttccattcttggaccattttaactttcccagc
cgccagagagcccgccggctggcaagacagttcgccaatgaactatgtcaaacggtacag
cggggccaccaacacgcccatacggacaagtcgacttcgaacgttggatgcagtgtcatt
ggggcctttgagcagggaattcttagcgagaagcagttcaggaacaacatggttagcgtc
tttctggccggccacgagaatccacagctgctgctcgtctcgatgatgttcctgcttggt
gagcatcaggaaatccaggaaagagttcgcgaggaggtactctcgcttggcgaagacgag
ctgccgtattctgttctccaatcggctccgttcttgacgtcagtcatatacgagaccctg
cggatgtatcctccgatctcccagctgattaaccgtcgtacgaccaagcctgttcttctg
ggaggcaaaatccctcttccggctggcacgtacatcggctacaatgcgtatgcgaccaat
cgagacaagcaatcctggggcgccgacgccgatgagttcaaacccgagcgctggggtcgc
acagtcgatgagatcaatgtgacgttcagaaaagcgaacgccaagggagccttcatctcg
tttcacgggggtcgcagggcatgccttggccagaagtttgccatgtttgaagccaggatc
gcaatggcagagatactgcggtcgctaaggtggaagatcgatccgacctggcctcgtaga
atgacaccagtgagctggccctctttacccgagaaacctgcgggttga

DBGET integrated database retrieval system