KEGG   Coccidioides posadasii: CPC735_057750Help
Entry
CPC735_057750     CDS       T01332                                 

Definition
Dolichyl-phosphate-mannose-protein mannosyltransferase containing protein (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cpw  Coccidioides posadasii
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    CPC735_057750
Enzymes [BR:cpw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     CPC735_057750
Glycosyltransferases [BR:cpw01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   CPC735_057750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 954 aa AA seqDB search
MPSKSSKAGLEAKSPSRRSSRSPGRSPGPKNRRKATAQVSDYTSEGVRDYDIFELPKSDY
KVMLCITALATIVRLFRIYQPSSVVFDEVHFGGFAMKYIKGKFFMDVHPPLAKLLITLAG
FLGGFRGDFDFKEIGKDYLEPGVPYVAMRMLPAVLGILSVPTMFFTLKASGCRTITASLG
ALLVTFENGLVTQSRFILLDSPLVFFTALTVLSFTSFTNQHEQGPSKAFGPAWWFWLTAT
GLFLGATLSVKWVGLFTVAWVGSLTVLQLWVLLGDTRTVTVDIWFKHFFARAFCLIIIPL
TMYLAMFAIHFLCLVNPGEGDGFMSSEFQATLNSKGMKDVPADVAFGSRVSIRHHNTQGG
YLHSHSHMYPTGSKQQQITLYPHKDENNIWIMENQTQPLGSYGQVQGPHAWDNLTAGFIE
NGATIKLYHVTTDRRLHSHDHRPPVTEADWQNEVSAYGYEGFPGDANDLFRVEIVNSLSK
GAEAKKRLRTIETKFKLVHVMSGCVLFSHPVKLPSWGFEQQEVTCAKGGSLPNSIWYVEH
NEHPMFGPDVEKVNYTRPGFFAKFWELQRVMWRTNAGLVESHAWDSRPTSWPLLLRGINF
WAKSHRQIYLIGNPLIWWASTASIVAYVIFKGLAVVRWQRGFGDYHNVNFKRFDYEIGQT
VLGWAFHYFPFYLMARQLFLHHYFPALYFAIIAFCQIFDFVANRLTLCGSKKNTIAGSVF
FVLFLAASIATFTLFSPLAYGNPWTQDACRKVKLLSSWDFDCNTFYTDLAQYSSIANVGS
SQPKATVTPPKAPAQEPASQQQKQPQEPPQRNGQQEQQKEKEKEPAEKAEFTMPAGQRVI
NSEESVEYRDQDGNLLDPEQVASMAKAGNVSFKTRYETRTRVIDGQGREVKQNVAPPHPD
VEGQNPETVGKDNKNIPGDKPASVPGDEKSVPQEDQKPKPASEGKEATRNADEL
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgccttcgaaatcctctaaagccgggttggaggctaaatccccctctcggcggagcagc
cggtctcctggtcgttctcccggccccaagaatcggcgtaaggctaccgcccaagtgtcg
gactatacatctgagggcgtgcgagactatgacatttttgaattgcccaagtccgactac
aaagtaatgctctgcattacggcgcttgcaacaattgtacgattgttcaggatctaccag
cccagcagtgtcgtattcgatgaggtccactttggcggttttgcgatgaagtatataaaa
gggaaattctttatggacgtccacccgccattggcgaaattgcttattactcttgccggc
tttcttggtggattccgtggtgatttcgacttcaaagaaattggcaaagattatttggaa
cctggagttccttatgttgcaatgcgcatgctaccggcggttctcgggattttatctgtt
cctactatgtttttcaccttaaaggcctccggttgccggactataaccgcctccctcgga
gcgcttcttgtaacattcgagaacggattagtgacccagtctcgatttatccttcttgac
tctccattggtcttctttacggcgttaacagtgctttcattcacaagttttacaaatcag
catgaacagggaccgtcaaaggcatttgggcctgcatggtggttctggctcactgctact
gggcttttcctaggtgccactctcagtgtcaaatgggtgggtttgttcacagttgcatgg
gttggtagcttgacagtccttcagctctgggtgcttctaggggataccaggaccgttaca
gtggatatctggttcaagcactttttcgctcgagcgttttgcttgatcatcatccctctt
actatgtaccttgcaatgttcgccatccattttctctgtctagtaaaccctggggaaggt
gatggtttcatgtcctcagagttccaggcaacacttaattccaagggaatgaaagatgtg
cctgccgatgttgcattcggctctagggtctcgatcagacatcacaacacgcaaggtggc
tacttgcattcccatagtcacatgtatccaacgggaagcaagcaacaacaaattacacta
taccctcacaaggacgaaaacaatatttggataatggagaaccaaacacagccacttgga
tcctatggtcaagttcaaggccctcatgcatgggataacctcactgctggttttattgag
aacggtgctaccatcaaactctatcatgttaccactgaccgaagactccactctcacgac
cacaggcccccagtcaccgaagctgactggcagaatgaagtctctgcttatggttacgag
ggctttcccggcgatgccaacgatctattccgtgttgagattgtgaactctctttccaag
ggcgcagaggcgaagaaaaggctcaggaccattgagactaagtttaagcttgtgcatgtt
atgagtggttgcgttctgttctcgcatccagtcaagctcccgagttggggttttgagcag
caggaagtgacctgcgccaaaggtggttcgctgcccaatagcatctggtatgtcgaacat
aacgaacatccaatgttcggaccggatgtggagaaggtcaattacacacgccctggtttc
ttcgccaagttctgggagcttcagcgcgtcatgtggaggaccaatgctggtttggtggaa
tcgcacgcttgggattctcgacccacttcttggccacttctgttacggggcatcaatttt
tgggccaaaagccaccgtcagatctatctcattgggaatcctcttatttggtgggcgtct
accgcttcaatcgtggcatacgtgatctttaaagggcttgcagtggttcgatggcagcga
ggtttcggcgattatcacaatgtcaatttcaagcgcttcgactacgagattggccagaca
gtcttgggctgggcttttcactacttcccattttatctcatggcccgtcagcttttccta
catcattatttcccggccctgtacttcgctattattgcattctgtcagatcttcgacttt
gtcgcgaaccggttgactctttgcggttcaaagaagaataccatcgccggtagcgtgttc
ttcgttttgtttttggccgcaagcattgcaacatttacgttattctctccattggcatat
ggcaacccatggacccaggatgcttgtcgcaaggttaagctgttgagctcatgggacttt
gattgcaataccttctatacagacttggcccaatattcctctattgcaaacgtcggctca
tcccagccaaaggcaacagtaacccctccgaaggcgcctgcgcaggaaccggcttcccaa
cagcaaaagcagccgcaggagccaccgcagcgaaatggacagcaggaacagcaaaaagaa
aaggagaaagagcctgctgaaaaggcagagttcacgatgcccgcaggccaacgagttatt
aatagtgaagaatccgtggaataccgcgatcaagatgggaaccttttagacccagaacag
gttgcctctatggcaaaggctggtaatgtatcctttaagaccaggtatgagacacggacc
agggtgatcgatggacaaggacgtgaggtcaagcaaaacgttgctccaccacatccggat
gtcgaaggacaaaaccccgagactgtcggaaaggacaacaaaaacattccgggagacaag
cctgcttccgtacctggtgatgaaaaatccgtgccgcaggaagaccaaaaaccaaaaccc
gccagtgagggaaaggaagccaccagaaatgcagatgaattgtaa

DBGET integrated database retrieval system