KEGG   Coccidioides posadasii: CPC735_059430Help
Entry
CPC735_059430     CDS       T01332                                 

Definition
(RefSeq) OB-fold nucleic acid binding domain containing protein
  KO
K10739  
replication factor A2
Organism
cpw  Coccidioides posadasii
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CPC735_059430
   03420 Nucleotide excision repair
    CPC735_059430
   03430 Mismatch repair
    CPC735_059430
   03440 Homologous recombination
    CPC735_059430
DNA replication proteins [BR:cpw03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    CPC735_059430
DNA repair and recombination proteins [BR:cpw03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     CPC735_059430
   MMR (mismatch exicision repair)
     CPC735_059430
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     CPC735_059430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 295 aa AA seqDB search
MEYGYGDQFPSGSYGQGGGGGGGGEGGFMSEVGASQSGKTYNKSSLRPVTIKQLNDATQA
YSDADFKIDDTEVAQVSFVGQIRNISQLSTFITYKLDDGTGEIEVKKWLDNEERHEGDAM
DTSDPTTGRTGKKELVVNGYAKVWGKLGSFSNNRRSVTAHVIRPLTNMDEYHCHFLEATA
IHLYFKHGPPPSKDAADVSKAQTSGSGGAMRSDNSMAAGERTLPPMSPMARKLFNTLNNT
PQSREGLHLQHLASLMQAPVDNVEKAARELNDLSLIYPTVDDYTWTIMDFKVDMQ
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggagtacggatacggcgaccagttcccctctggctcgtatggccaaggtggtggtggt
ggtggtggtggtgaaggaggatttatgagtgaggtgggagctagtcaaagcggaaagaca
tacaacaagagttcgcttcgaccggtcacaatcaagcaactaaatgatgcgacgcaagcc
tattcggacgcagattttaaaatcgacgatactgaagtcgcccaggtctcatttgtaggc
cagatccgcaacatatcccagttatcaacattcataacatacaaactggacgacggaacg
ggggaaatcgaagtgaaaaaatggctggacaacgaagagcgacatgagggtgatgctatg
gacacaagcgaccctacaacaggccgtacggggaaaaaggaactcgtggtgaacgggtac
gcaaaagtatggggaaaactgggctcgttcagcaacaatcgtcgttcagttaccgcacat
gtaattcggccgctgacgaatatggatgaataccactgccacttccttgaagctacagcg
atacatctctactttaaacatggcccgccaccaagtaaagacgcagccgacgtttcaaag
gcccagacctctggctccggaggggcgatgcgctcagataacagtatggccgcgggcgag
aggactcttccgccaatgtctcccatggctaggaaattgttcaacaccttgaataacacc
ccacagagcagagaggggctgcatctacagcacctggcgtctctcatgcaggcaccggtc
gataatgtggaaaaggctgcgcgggagctgaacgacttgagtctgatctatccgactgtg
gatgattatacttggacgataatggattttaaggtcgatatgcagtaa

DBGET integrated database retrieval system