KEGG   Coccidioides posadasii: CPC735_060020Help
Entry
CPC735_060020     CDS       T01332                                 

Definition
kinase domain containing protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
cpw  Coccidioides posadasii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1431 aa AA seqDB search
MVGVSAISTMSNKIPPQRLPKSSQSRMSLSDSSTRDHNDSSSSGAELPLRTVLRKNASNA
SVARSQTYDSHAGSTAGVTGTRRRKSILERGSTFGSRDVDSARRVPSSTFGNPMRSSNTS
LDSGNPPSRTQSNAGSSTVNEENETLSENGEFLVPVNFDDFHNSITSKEPSLSHFPLPGR
GAAGYEGTVAIPKPTNRWTTGPSVQTAKEPRPAGVTRRLSNATRSGQTSAGSKPAPSSVS
STGRARRQSYVPPVPTSMVAPRRPRKSIGPGSLVSENGESLPPPMRRPSFSRKKTMEENR
VMPNAASRNSHQETSDSAFNSAALHAVRSQKARSLQPPSHTVRDNATTSPTIGDHSRSSS
HVIRTPVKGAIVKLTTPSSSKRISIMPPHATGLGARTISPTDARRMKRMSLIPHPPPLPR
TSPTHLDLGFPRPRSSAPSPSAIPRKSVTPSSTRTTPDQHRKSYGSGISLSSSTSYNSAR
NSSGSFQARLSQNVSSSRLPTPKPRTDNNNIRNTEDDVPPVPAIPKLYESPKNEHHLSFI
SRKSSLPLEVPNFADMSKLDSDSSSSRPGDGVHVSKRTLAETPAKETKQRPPVNLSKKNL
QPLKLPPLNLLPLSVPINTKIDALREKASQDLAPQVAATPPRPINAKTPSTPMTASKASF
FNEIPPVDPGRCNTSHFALRTDFAKFRAENSSSAFDTLEFSSSRNISPYISSSLPRGGDE
PGFVRNQISDSYSKPTPSKLIGPRPQTQISSLSNTDLFAFGLTPDDAETEISFPPPSPRR
ADDRVHSKIQIISDASMDPVKYDSMPPPKLPASATWNNLSTTRVSPTSKQAQLKSKRSTS
ISNLVNVPSPRRNQSISSEQGLAKNPSLTIDSGDTEASGNKPNSSILSPVHKLLAGSKPS
PTPKPRLQDQIGDRDDAAAEEEMRKLGSKRKDFEVAARELEDLRRRASPKERASPAQALK
VANLNIFERGEIIDFKDIYFCGTHKAKKLVGDLNASTGNFGYDDDRGDYNIVIGDHLAYR
YEIIDVLGKGSFGQVVRCVDHKTGTLVAVKIIRNKKRFHQQALVEVNILQKLKEWDPNRR
HSVVNFVQSFYFRGHLCISTELLGMNLYEFIKAHEFRGFSLKLIRRFTKQILSTLVLLHN
KRVVHCDLKPENILLVNPLQTGIRVIDFGSSCFENEKVYTYIQSRFYRSPEVILGMSYGM
PIDMWSLGCILAELYTGYPLFPGENEQEQLACIMEVFGPPEKHLIEKSTRRKLFFDSTGK
PRDVVSSKGRRRKPSSKSLRHVLKCDDAAFLDFLARCLRWDPARRLNPHDAMNHEFITGM
KFNPRARLHLTSMGHSPAKRHTSGSTPGVRPLPEPPSKRGAARNSSNNSPVRPGVVKRQT
VQNVTSTPATKRTSNPPPAAGSALPRAAGRSASGKLDLAAAAAATSLKTRV
NT seq 4296 nt NT seq  +upstreamnt  +downstreamnt
atggtgggcgtttctgccatttcgaccatgtcgaacaagatcccccctcagagattgccc
aaatcatcacagtcacgcatgtccctgtcagactcgtcaactcgggatcacaatgacagc
tctagctctggagccgaactgccattacggacagtcctacgcaaaaacgcctcgaacgct
tcggttgctcgctcccagacgtacgattcacatgccgggagtacggctggtgtcaccgga
accaggaggagaaagtccattctcgagcgtggttcaacgttcggctcccgagatgtggat
tctgcgcgacgggttccatcgagcacgtttggtaacccaatgcggtccagcaatacctcc
ttagattccggcaatcctccgtcgcgaactcagtcaaatgcaggtagctcaacggtgaac
gaagaaaatgaaacactatcggaaaatggggagttcctcgttccagttaattttgatgat
ttccacaacagcatcacgtcaaaagagcctagtttgagccattttccgttgcctggtcgt
ggtgcggctggttacgagggtacggtagccatcccaaaacctacgaatcgctggacaacg
ggtccttctgttcagactgcaaaagagccgcgaccagcaggtgtgactcggcgtcttagc
aatgctacgcgctccggtcagacttctgcgggatcaaaacctgctccgtcatctgtatcc
tcgacagggagagcaagacgccagagttacgttccccccgtaccaaccagcatggtcgct
cctcggcgacctcgaaaatcgatagggcctggaagtttggtatcagaaaatggcgagagc
cttccccctcctatgcgaaggccgagcttttcgagaaagaaaacaatggaagagaatcgg
gtgatgccaaatgctgcatcccgcaactcccaccaagagacgtcggattccgccttcaat
tcagcagcgctacatgcagttcgcagccagaaggcaagatcgctgcaaccaccaagccac
accgtgcgggataatgcgacgacgagcccgactataggggaccattctcgatcttcgagc
catgtgatccgcacacctgtgaaaggtgcaatcgtcaagctgaccaccccatcttcgtcg
aagaggatttcgatcatgccaccgcatgccactggactaggcgcgcgaactatcagccca
acagatgcacggcgcatgaagaggatgtcacttattccacacccccctcccttaccccga
acctctcccacacatctcgatctcggttttccccgtccacgatcttcagctccatcccct
tcagcaatacccaggaaaagcgtgacgccgtcatccaccaggacaactccagaccagcat
cgcaaatcgtacggttctggcatatccttatcgtctagcacaagctataattctgcgcgc
aactccagcggttccttccaagcacgtctttcgcaaaacgtttcttcttctcggctccct
acacctaaacctagaacggataataataatatcaggaacacagaggacgacgtccctccg
gtgcccgctattcccaaactatacgagtcgcccaagaatgagcatcatctatcattcatt
tcccgaaaatctagcttaccgctagaggttccaaactttgctgatatgtcaaagttggat
tcggactccagctccagccgtcctggggatggtgtccatgtctccaagcgaacgcttgcc
gaaactcccgccaaggagacgaaacagaggccaccggtcaatctcagcaaaaagaatctc
cagccattgaagcttcctcctcttaatttactcccccttagtgttcctataaataccaaa
atcgatgcgttgcgcgaaaaggcatcccaggacttggcgcctcaggtagcggcaacgcct
ccccgtccgatcaacgcaaaaacgcccagtacaccgatgacagcatcaaaagctagcttc
tttaatgaaatccctcccgttgatccgggacgttgcaacacatcacattttgctctcaga
acggattttgcaaagtttcgagccgagaatagttccagtgccttcgatacgttggaattt
tcatcctcaaggaacatttctccttacatctcgtcttcccttcctcgaggtggtgacgaa
cctggatttgtacgcaaccaaatatcggactcatattcgaaacctacgcctagcaagctc
atcggtccgcggccacaaactcagatctcgtcgctctcaaacacagatctgtttgccttt
ggtctcacgcctgatgatgctgaaacggaaataagctttccccctccctccccgcggagg
gcagatgatagagttcactccaaaatacaaattatctccgacgcttccatggatcctgtc
aaatatgatagtatgccaccgcccaaacttcccgcgtctgcgacgtggaacaacctttcc
accacgcgagtaagcccaacttcgaaacaggctcaacttaaatcgaagagaagcacatcg
atttctaatttggtaaatgtgccgtcaccacggaggaaccaaagcattagtagcgagcag
ggccttgccaagaatccaagcctgaccattgattctggtgatacggaggcatcaggtaac
aaaccgaattcgtcaatcctgtcacctgtgcataagcttctggccggatcgaagccgtcg
ccaactcctaaacctcgtcttcaagatcagatcggcgatcgagatgatgctgctgctgaa
gaagagatgcgcaaacttggtagcaagcgaaaggactttgaggttgcagcacgggagctg
gaggatctccgtcgccgagcgagcccgaaggagcgggcgtctcctgcccaggctctaaaa
gttgcgaatcttaatatttttgaaagaggagagattatcgatttcaaagacatctacttc
tgtggcactcacaaagccaaaaagcttgttggtgatctaaatgcgtcgactggcaatttc
ggctatgatgatgatcgtggcgactacaacatcgtgataggagaccacctcgcttatcga
tatgaaattatagacgtccttggaaagggaagcttcgggcaggttgttagatgtgtggac
cacaagacgggcacgcttgttgcggtgaagatcatccgaaacaaaaagagattccatcag
caggctcttgtcgaagttaatatattacagaagctgaaagaatgggacccaaaccgtcgc
catagcgtcgtaaactttgtccaaagtttttacttccgtggccatctttgcatatctacc
gagctgctgggaatgaatttatatgaattcatcaaggcacacgagttccgtggcttctcg
ctgaaattgattcgacggttcacgaagcagatcttgagtacacttgtccttcttcacaac
aagagggttgtccattgtgatttgaagccggagaatattctgctggttaaccctctccaa
accggaatcagggtcatcgacttcggctcgagttgttttgagaacgaaaaagtgtacact
tacatccagagccgcttctatcgctccccagaagtaattttaggcatgtcctacggcatg
cccattgacatgtggagtcttggttgtatcttggctgaactatacacgggctatcctctc
ttccccggagaaaacgaacaagagcagctggcatgtattatggaagtctttggccctcca
gagaagcatctcatcgaaaaaagcactcgacgaaaactcttctttgactctaccggcaaa
ccccgcgatgtcgtttcatccaaaggccgtcggagaaagccaagttccaagagtctccgc
catgtgctaaaatgcgacgatgccgcgttcctcgatttcctagcacgatgtctccgatgg
gacccagcgcgtcgcctcaatccacacgatgcgatgaaccacgagtttattactggcatg
aagttcaatccccgtgcaaggttgcacttaacgtccatgggtcattctcccgcaaaaaga
catacgtcgggttcaacgccaggcgtacgccctcttccggaaccaccgtcgaagcgagga
gcggcaaggaattcatccaataattctcccgttagacccggcgttgtaaaacgtcagacg
gtacaaaacgtcacctccacgccggcgacaaaacggacttccaaccctcctcccgcggcc
ggttctgccctcccgagagctgcaggcagaagtgcgagtgggaagctagacctggctgcg
gctgcggctgcaactagtttgaagactagagtttag

DBGET integrated database retrieval system