KEGG   Coccidioides posadasii: CPC735_060320Help
Entry
CPC735_060320     CDS       T01332                                 

Definition
Palmitoyl protein thioesterase containing protein (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
cpw  Coccidioides posadasii
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CPC735_060320
  Lipid metabolism
   00062 Fatty acid elongation
    CPC735_060320
Enzymes [BR:cpw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     CPC735_060320
Lipid biosynthesis proteins [BR:cpw01004]
 Fatty acid synthase
  Component type
   CPC735_060320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 326 aa AA seqDB search
MKFRTLQNAYFLSHLLSPIVSFPVFPSSTSETTQLPLVIWHGLGDDFAREGLKHIAQLAE
DTNPGTYIHIIHVGDTPEADRQASFLGNVTVQLETVCKQLESDPILSTAPAVNALGFSQG
GQFLRGYVERCNSPPVRNLVTFGSQHNGIAKFQSCAATGDWVCRGAEALLRFGAWSNMVQ
SRFVPAQYFRDPEELDQYLLHSNFLADINNEREIKNEQYKRNLISLNKFAMYMFKDDKLV
VPKQSAHFAEVNSTTGYVKPLQERAIYTEDWLGLKVMDEAGSLEFLTVPGEHMQLSDRVL
KEAFEKYFGPVEVDLASHPELVLQVQ
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttagaacgcttcaaaacgcttatttcctttcccacctcctttcacccattgtc
tctttcccggtttttccttccagtacctccgaaactacgcaactcccactggtcatctgg
catggccttggcgatgactttgcccgtgaaggcctgaaacatatcgcacaacttgccgaa
gatacaaatcccggcacatatatacacattattcatgttggcgacacgcctgaagcagac
cgccaggcgtcattccttggcaatgtgaccgtccaactcgaaactgtctgcaagcagctt
gagtccgacccgattctcagcactgcgcccgctgtcaatgcactgggcttctctcagggt
ggtcagtttctgcgtggatatgtagaacgatgcaatagccctcccgtacgaaatctggtt
acgttcggaagccagcacaatggtattgcaaaattccaatcgtgcgccgcaacgggtgac
tgggtgtgccgtggcgctgaggcacttttgagatttggagcgtggtcgaatatggtgcag
tctcggtttgttccggcgcagtatttccgtgatcccgaggagctcgaccagtatctcttg
catagcaatttcttggctgatatcaacaacgaacgggagatcaagaacgaacaatacaag
cgcaatctcatttcgcttaataaatttgccatgtacatgtttaaagatgacaagctggtt
gtgccgaagcagagtgcgcatttcgccgaagttaacagcacgactgggtatgttaagccc
cttcaggagcgagcaatctacactgaggattggctgggtctgaaagtcatggatgaggct
gggagtctggagtttttgacagtcccaggggagcatatgcaactgtctgaccgtgttttg
aaggaggcgtttgagaaatactttggtcccgtcgaagttgatctagcttcacaccctgaa
cttgtactgcaagttcaatga

DBGET integrated database retrieval system