KEGG   Coccidioides posadasii: CPC735_060320Help
Entry
CPC735_060320     CDS       T01332                                 

Definition
Palmitoyl protein thioesterase containing protein (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
cpw  Coccidioides posadasii
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cpw01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:cpw00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 326 aa AA seqDB search
MKFRTLQNAYFLSHLLSPIVSFPVFPSSTSETTQLPLVIWHGLGDDFAREGLKHIAQLAE
DTNPGTYIHIIHVGDTPEADRQASFLGNVTVQLETVCKQLESDPILSTAPAVNALGFSQG
GQFLRGYVERCNSPPVRNLVTFGSQHNGIAKFQSCAATGDWVCRGAEALLRFGAWSNMVQ
SRFVPAQYFRDPEELDQYLLHSNFLADINNEREIKNEQYKRNLISLNKFAMYMFKDDKLV
VPKQSAHFAEVNSTTGYVKPLQERAIYTEDWLGLKVMDEAGSLEFLTVPGEHMQLSDRVL
KEAFEKYFGPVEVDLASHPELVLQVQ
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttagaacgcttcaaaacgcttatttcctttcccacctcctttcacccattgtc
tctttcccggtttttccttccagtacctccgaaactacgcaactcccactggtcatctgg
catggccttggcgatgactttgcccgtgaaggcctgaaacatatcgcacaacttgccgaa
gatacaaatcccggcacatatatacacattattcatgttggcgacacgcctgaagcagac
cgccaggcgtcattccttggcaatgtgaccgtccaactcgaaactgtctgcaagcagctt
gagtccgacccgattctcagcactgcgcccgctgtcaatgcactgggcttctctcagggt
ggtcagtttctgcgtggatatgtagaacgatgcaatagccctcccgtacgaaatctggtt
acgttcggaagccagcacaatggtattgcaaaattccaatcgtgcgccgcaacgggtgac
tgggtgtgccgtggcgctgaggcacttttgagatttggagcgtggtcgaatatggtgcag
tctcggtttgttccggcgcagtatttccgtgatcccgaggagctcgaccagtatctcttg
catagcaatttcttggctgatatcaacaacgaacgggagatcaagaacgaacaatacaag
cgcaatctcatttcgcttaataaatttgccatgtacatgtttaaagatgacaagctggtt
gtgccgaagcagagtgcgcatttcgccgaagttaacagcacgactgggtatgttaagccc
cttcaggagcgagcaatctacactgaggattggctgggtctgaaagtcatggatgaggct
gggagtctggagtttttgacagtcccaggggagcatatgcaactgtctgaccgtgttttg
aaggaggcgtttgagaaatactttggtcccgtcgaagttgatctagcttcacaccctgaa
cttgtactgcaagttcaatga

DBGET integrated database retrieval system