KEGG   Coccidioides posadasii: CPC735_062390Help
Entry
CPC735_062390     CDS       T01332                                 

Definition
(RefSeq) Transcription factor tfb2 family protein
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
cpw  Coccidioides posadasii
Pathway
cpw03022  Basal transcription factors
cpw03420  Nucleotide excision repair
Module
cpw_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CPC735_062390
  Replication and repair
   03420 Nucleotide excision repair
    CPC735_062390
Transcription machinery [BR:cpw03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CPC735_062390
DNA repair and recombination proteins [BR:cpw03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     CPC735_062390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tfb2 Helicase_C_3
Motif
Other DBs
NCBI-GeneID: 9696006
NCBI-ProteinID: XP_003070511
UniProt: C5P3U8
AA seq 487 aa AA seqDB search
MPVSSSRPLEYLESLPGTVFLKLYQQPSTALAIFRRMLPHLAKCFVMALLYLKDPLPAAE
LELWVKAGSKRERDNALSILSRLHILSSTTTSDHVRAYMVTNPFSSSLRQALTGGDKQHS
FGVMSSMPDPHPMTVSDLDDYARRQWEGVLGYMVGTNSLGIQRENVTLSKGVKSLLQACH
LVEVRDRRVEITKEGFAFVLQDVNTQVWHILILYVENAEAIGMDSVEVLSFLFLLSSLEL
GQSYDKKHLTSTQLRTLADLTDFGIVYQHSPASESTRFYPTRLATTLTSDSMALSSPISG
NLAPAGPNINAATGAPGTGFIIIETNYRLYAYTSSPLQISLIALFTTLKYRFPNLVTGKL
TRQSIRRAVEMGITADQIISYLTTHAHPQMRKVNASKSTSTTAGLPASVLPPTVVDQIRL
WQLERDRLKATPGFLFKDFASSAEFEAPCRYAEEIGVLVWKSEKRRMFFVTRHEQVAAFL
RSRASRS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtttcttcgtcccgtcctctagagtatctagagagccttccgggcacagtcttc
ctcaagctgtatcagcagccttcaaccgctctggcaatctttcgccggatgctgccccat
ctagcaaaatgttttgtcatggcccttctctacctcaaagaccccctgccagcagctgag
ctcgagctgtgggtcaaggcaggaagcaagcgcgagagagacaacgccctgtcgatcctt
agtcgattacacattctttcaagcactacaacgtcggaccacgttagggcgtatatggtg
accaatccattttcctcctctctgcgacaggcgctcaccggcggagacaaacaacattct
tttggagttatgtctagtatgcctgatccgcaccctatgactgtctccgatctagacgat
tatgccaggcgacagtgggagggtgttcttgggtacatggtcgggacaaactcgctgggc
attcaacgtgaaaacgtaacgctgagtaaaggagtcaaatccctcctccaagcctgccac
cttgtcgaggtccgagatcgcagagtggaaatcaccaaggaagggtttgcctttgtattg
caagatgtcaatactcaggtctggcatattctcatcctctacgtcgagaacgccgaagcc
atcggaatggatagcgtcgaggtgctctcctttctcttcctcctcagtagcttggagcta
gggcaatcctacgacaaaaagcatctaacttcaacgcaactccgtacccttgccgacctc
actgatttcgggatcgtttaccaacattcccctgcttcggaatccacacgcttttaccct
actcgattagcaacaacgcttacatccgactccatggctctctccagcccgatctcaggc
aaccttgctccagctggtccaaacataaacgccgctactggtgcgccaggcacaggattc
ataatcatcgaaacaaactaccgcttatacgcgtatacctcttcccctcttcaaatttcc
ctcatcgcactcttcacaacacttaaataccgctttcccaaccttgttacgggaaagcta
acacgccaatccatccgtcgcgccgtcgaaatgggcatcactgccgaccaaataatatct
tacctcacgacccatgctcacccccagatgcgaaaagtaaacgcatcaaagtccacttca
accacagctggacttcctgcgtctgttctaccgcccacagtcgttgatcaaatccggctc
tggcagttagaacgtgataggctgaaggccacaccaggatttttgttcaaagatttcgca
tcttcggcggagtttgaagccccgtgccggtacgcagaggaaatcggtgttttagtttgg
aaatcagagaaacgaagaatgttctttgtcacgagacatgagcaagtcgccgcttttttg
agaagtagagcctctagaagttga

DBGET integrated database retrieval system