KEGG   Coccidioides posadasii: CPC735_063980Help
Entry
CPC735_063980     CDS       T01332                                 

Definition
Patatin-like phospholipase family protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
cpw  Coccidioides posadasii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CPC735_063980
Enzymes [BR:cpw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CPC735_063980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1575 aa AA seqDB search
MNLTTTMPAAVAPDPPAQLAVSSWSLSESSDAAGASRTSSSCRASSTSHCPTHAWNPDPP
PSSLQPVFSFSPSLPPPCPSPAISSCPPNTLSPPNLLQGIVSQLAMASYIGRLLLYLFQV
VPSLLYWAITFTTITVPTALFTLFSMSLTFTMNFTTLLIIVLLLVSTVSWFIRYRFLNIY
SRLPPEPQRKEPEIDLFPDSQDGDSKPGLSNYLDEFLSAIKVFGYLERPVFHELTRTMQT
RKLIAGETLLLEEEKGFCLVVDGLVQIFVKSIQERDDDRDGWQLDEAVDDSADEDDEIRR
RGHQGYQLLTEVKNGASMSSLFSILSLFSEDIKLRHNEDMESSSSSFNNVPAPDSNPMSP
ALLLESPTRVSFPDQRDIPTQPSADTLPKVSPLALEGSPGPFEHDPKPRGHRRKRPSRPK
RAKSVHPDILARAMVDTTIAIIPASAFRRLTRVYPKATAHIIQVILTRLQRVTFATAHSY
LGLTTEVLSIEQQMTKYTSFDLPNHLRGAALDKLKSKFTKEKERLGPEDGTKGIALHNPA
LNRRRRSSSSLRKDAALHAKLTVVRGKGSASNPVRYGDHESTGVSPGDLLSTIQLSRFGP
RYGSERLNGRSVFYDAASGMKTPAGGPPSPLATPGQPLFRFPAQNVTFQRQDSLDQDAIF
RESILDCMMKALGLTGSTQDALRKTHNSGDASPHLVSYDSRRQKAVFNNAFGFIDPYDGF
GDGDSESLMSMSVTSAGGTSPVHNLRTELQDEIEIVYFPKGSVLIEQGEHNPGLYYVIDG
FLDVGIPVNEKGEDLIGSSRRPTAEDILLPITGNASRVSSTLGTAHNQRKKASRRSLYMV
KPGGVEGYIGSITSYRSFTDVTAKTDVYVGFLPRAVLERIADRYPLVMLTMAKRLTTVLP
RLILHIDFALEWVQVNAGQVIHHQGDESDAIYIVLNGRLRAVLDKGDGKVSVLGEYGQGD
SVGELEVMTESTRPGTLHAIRDTELAKFPRTLFNSLAQEHPGITIQISKLIAQRMRHIID
NPLEKGSDKGSPDSTKPTTSTLNLRTVAVLPVTAGIPVVEFGNRLLNAFNQVGVTNGVTS
LHQADILNHLGRHAFSKMGKLKLAQYLADLEERYGMVLYVGDTSVNAPWTQTCIAQADCI
LLVALAEGSPAIGEYERFLLGMKTTARKELVLLHAERYSQPGLTRQWLKNRMWINGGHHH
IQMAFRLTAEPVHPETKRLGAVLKQRVQVIQAEIQKYTSRRIRQTPVYSTSTPVKGDFHR
LARRLCGKSVGLVLGGGGARGIAHIGVIKALEEAGIPIDIIGGTSIGSFIGALYARDADV
VPAYGRAKKFSGRMASMWRFALDLTYPSASYTTGHEFNRGIFKAFGNSHIEDFWLEFYCN
TTNISKSRLEFHSSGYAWRYVRASMSLAGLIPPLCDEGNMLLDGGYVDNLTVARMKSLGA
DVIFAVDVGAIDDNTPQGYGDSLSGFWALVNRWNPFSSLPNPPTLSEIQARLAYVSSVDA
LERAKSTPGCLYMRPPIDAFGTLDFAKFDEIYQVGYKFGKEFLDRLKNEGGLPIQEETEE
KKKLRRTMAPRRASI
NT seq 4728 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgacgaccaccatgcctgcggctgtggcgcccgaccctccagcgcagctcgcc
gtctcgtcatggagcttgagcgagagcagtgacgcagctggtgcctccagaacctcgtcg
tcctgccgggcctcgtcgacctcgcactgcccgacccatgcctggaatccggacccaccg
ccctcctccctccagcccgtcttttctttttctccctccctgccgccgccctgcccctcc
cccgcgatctcctcctgtcctcccaacaccctctctcctccaaatctcctccagggcatt
gtgtcccagctcgccatggcgtcctacatcgggcgtctgctcctctacctcttccaggtc
gtgcccagcctgctctactgggccatcaccttcactacaatcaccgtcccgacagctctg
ttcaccctcttttccatgagcttgacctttaccatgaactttacgacacttctcataata
gtattgcttcttgtatctaccgttagctggttcatccgttatcgatttcttaatatctac
tcccggttaccgccagagccgcagaggaaagagcccgagatagacctctttcccgactcg
caggatggcgactcaaaacctggcttgtccaattaccttgacgagtttctcagcgccata
aaagtgttcggctacctggagcggcccgtctttcatgagcttacacgaacaatgcagaca
cggaagttgattgccggtgaaacgctgctgttggaagaggagaaaggattttgcttggtc
gtcgatggattggtccagatatttgtcaagtcgatccaagagcgggacgatgatcgggat
ggctggcagctggatgaagccgttgacgattcggccgatgaagatgatgagattcggcgt
cggggtcatcagggataccaattgctcactgaggtgaaaaacggtgcgtcgatgtcgtct
ctcttctcgattctatccctattcagcgaagatatcaaattacgtcataacgaagatatg
gagtcaagctcctcaagctttaacaatgtccccgcacccgattcaaacccaatgagcccg
gctcttcttttagagagtcccacgagggtgagctttcccgatcagcgagatatcccaacg
cagccaagcgcagacactctgcccaaggtctcccctctagctttggagggaagccccggt
ccattcgagcacgatccaaagccccgcggccatcgacgcaagaggccctcaaggcctaaa
cgggccaagtccgttcatcccgacattttggcgcgagctatggtggatactaccattgca
attattcctgcgagtgctttccgacgcttgaccagggtgtacccgaaggctaccgcccat
atcatacaggttattctcacgagacttcagcgcgttacatttgctactgcgcattcatat
ctcggattaaccaccgaagttttgagcattgaacagcaaatgaccaaatatacatccttc
gacctacctaaccaccttcgtggagcagcgttggataagctaaagtctaaatttacaaaa
gaaaaggaaagattaggccccgaggacgggacaaaaggcattgcgcttcacaacccggct
ctcaaccggagaagaaggtctagtagttcactgagaaaagatgctgcattacatgctaag
cttacagtggtgcgaggaaaaggatcagcttcgaatcctgttcgatatggtgatcatgaa
tccaccggtgttagccctggagacttattatctaccatacaactctcgcgctttggccct
cgatacggaagcgagcggttgaacgggaggagcgtcttttatgatgcagcttctggcatg
aaaactcctgctggagggccaccaagtccactagcgacccctggacaaccgctgtttaga
tttccggctcaaaatgttaccttccaaagacaagattctttggatcaggacgctattttc
cgtgaatccattcttgattgcatgatgaaggcactggggctcacgggaagcacccaagac
gccttgcgcaaaacgcataattccggggatgcttcccctcacctagtctcctacgactca
cgccgtcagaaagccgttttcaataacgcctttggtttcatagacccatatgacggcttc
ggcgatggggattctgaatcgctcatgtcaatgtccgttacatctgccgggggcacgtcc
ccggttcataaccttagaactgaactacaagatgaaatcgagatagtttactttcccaag
ggctccgtgctcatagaacaaggggagcataacccaggcttatactatgtcattgatggc
tttctagacgtcggtattcctgtcaatgaaaagggagaagatcttataggttcttctcgg
agacctacagccgaggacattctactaccaattacaggtaatgcctcacgggtgtcgtca
acgcttggtaccgcacataaccagaggaagaaggcctcccggcgttccttgtatatggtt
aagcctggcggtgttgaaggatacattggttctataacgtcatatcgatcgtttacggat
gttaccgcaaaaacggatgtctatgttgggtttcttccacgagcggtgctggagagaatc
gctgatcgatatcctttggtcatgctcacgatggcaaaacggttgacgacggtcctgcca
cgacttattttacatattgacttcgctctcgaatgggtccaagtcaatgctggacaagtt
atacaccatcaaggggacgagagtgacgcaatttacatcgtcttgaacggtcgactccgt
gccgtccttgataaaggagatggaaaagttagcgtcctgggcgaatacggccagggcgac
agcgtcggagagttagaagtcatgactgaatcgacacggcccggtaccttgcatgcaatc
cgtgacacagagctggcgaaattccctcggaccttgtttaatagccttgctcaggagcat
cctggcataacaatccaaatttcaaagttgatagcccaacggatgcgtcacataatagac
aacccacttgaaaagggcagtgacaaaggcagcccagacagcaccaagccgaccacgtct
actttgaatttacgaaccgtggccgttctgcctgttaccgccggtattcctgtggttgag
ttcgggaacagactgttgaatgcctttaatcaggtcggcgtgacgaatggtgtcacttcc
ctccaccaagccgatattttaaaccatcttggccgacatgcgttcagcaagatgggtaag
cttaaactcgcgcagtatctcgcagatctcgaggagagatacggaatggttctgtatgtt
ggagatacaagcgtcaatgcaccctggacccaaacatgtattgcccaagcggattgcatt
cttcttgtcgccctagccgaaggttctcctgcgattggtgaatatgagcgcttccttctt
gggatgaagacgaccgcaaggaaagagcttgttcttttgcacgctgagagatactcccaa
cctggtctcaccagacaatggttaaagaatcggatgtggattaacggaggtcatcatcat
atccaaatggcgttccgtctgacagcggaacccgtccatccagagactaaacgcctcggc
gccgtgctcaagcagagagttcaagtcatccaggctgagattcaaaagtacacctctcgc
aggattcgccagacgccagtttattccacatcgaccccggtcaaaggtgatttccaccgg
ctcgctcgtcgtctatgcggcaagtctgtcgggctagtgctgggtggtggaggcgcaaga
ggtattgcccatattggcgtgataaaggcactggaagaggctggaatccctatcgatatc
attggaggcacatccattggatcctttattggcgcattatatgctcgagacgcggacgtt
gtccccgcatacggccgcgcgaagaagttttcaggacgcatggccagtatgtggcgtttc
gctttggatctcacttacccctcggcttcatataccaccggtcacgaatttaatcgcgga
atatttaaggcgtttgggaatagccacattgaagatttctggctagaattctattgtaat
acgactaatatcagcaagtcacgacttgagttccactcgtctggctacgcgtggcggtat
gttcgtgcttctatgtctctagcaggcttgatacctcctctctgtgatgaaggtaacatg
ctacttgacggtggatacgtggacaatctcacggttgcacgcatgaaatctctcggcgca
gatgtcatcttcgccgttgacgttggtgcgatcgacgacaacactccacagggatatggt
gattccctttccggcttttgggcattagtgaacaggtggaacccgttctcctccctccct
aacccgccaacactctccgagatccaagctcgactcgcatacgtttcgtccgtggatgct
ttagaacgggccaagtctacgccgggatgcctttatatgaggcccccgatcgacgccttt
gggactctggattttgcaaaattcgacgagatttaccaggttgggtacaagtttggcaaa
gagttcttggaccggctgaagaacgaaggtggattgccgattcaggaggagacggaagag
aagaagaagctgagacggacgatggcaccgcggcgggcgagtatttga

DBGET integrated database retrieval system