KEGG   Coccidioides posadasii: CPC735_064080Help
Entry
CPC735_064080     CDS       T01332                                 

Definition
Profilin II, putative
Orthology
K05759  
profilin
Organism
cpw  Coccidioides posadasii
Brite
Exosome [BR:cpw04147]
 Exosomal proteins
  Proteins found in most exosomes
   CPC735_064080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 132 aa AA seqDB search
MSWQAYVDTSLVGSGHIDKAAIFDNQGTSVWATSAGFSVSPAEVKVIVDSFNPVSGDAIK
EVQSGGFFVGGDKYVALRSDESRLYGKKGKEGVVIVKTKKALLIAHYPETVQPGAATNTV
ETLGDYLIGLGY
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggcaagcttatgttgatacaagtctcgtcggctctggccacatcgataaggcc
gccatcttcgacaaccaaggcaccagcgtttgggcaacgtctgccggattctcggtctct
ccggcagaggtgaaagtcatcgtcgactcctttaatcccgtatctggcgatgcgatcaag
gaagtgcagtccggcggattcttcgtcggtggagacaaatacgttgctctacgatcagac
gagtctcgcctctatggcaagaagggcaaagaaggcgtcgtgatcgtgaagacgaaaaaa
gctctcctcatcgcacattacccggaaaccgtccaacccggcgccgcgaccaacacggtg
gaaactctcggcgactacctcatcggattaggttattag

DBGET integrated database retrieval system